Knowledge Summary

Patent

No data available

Synonym

Accession P09565 Q96F00
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MTPGVVHASPPQSQRVPRQAPCEWAIRNIGQKPKEPNCHNCGTHIGLRSKTLRGTPNYLPIRQDTHPPSV      1 - 70
IFCLAGVGVPGGTCRPAPCVPRFAALPWATNHPGPGCLSDLRA                                71 - 113
//

Text Mined References (3)

PMID Year Title