Knowledge Summary

Patent

No data available

Synonym

Accession P09565 Q96F00
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MTPGVVHASPPQSQRVPRQAPCEWAIRNIGQKPKEPNCHNCGTHIGLRSKTLRGTPNYLPIRQDTHPPSV      1 - 70
IFCLAGVGVPGGTCRPAPCVPRFAALPWATNHPGPGCLSDLRA                                71 - 113
//

Text Mined References (3)

PMID Year Title
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
3167054 1988 Differential expression of the human insulin-like growth factor II gene. Characterization of the IGF-II mRNAs and an mRNA encoding a putative IGF-II-associated protein.