Property Summary

NCBI Gene PubMed Count 40
Grant Count 31
R01 Count 13
Funding $2,040,838.05
PubMed Score 783.52
PubTator Score 532.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.627 0.000
tuberculosis and treatment for 6 months -1.300 0.000
active Crohn's disease -1.020 0.040
psoriasis 2.000 0.000

 GO Function (1)

Gene RIF (22)

PMID Text
25679063 in acute myeloid leukemia patients the association of CD7 positivity and FLT3 positivity was found to be significant
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD7
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD7
24920488 Data show that CD7 promotes extramedullary involvement of the B-ALL line Tanoue in an integrin beta2-dependent manner.
24727323 We showed that the CADM1 versus CD7 plot is capable of discriminating clonally expanding HTLV-I-infected cells in indolent and acute-type T-cell leukemia-lymphomas and in asymptomatic carriers
24211252 SECTM1 secreted from bone marrow stromal cells may interact with CD7 to influence GM-CSF expression in leukemic cells.
24157461 CD7 is present on monocytes and tumor macrophages and its ligand, SECTM1, is frequently expressed in corresponding melanoma tissues
20398252 epigenetic down-regulation of CD7 is associated with acute myeloid leukemia.
20175919 These findings indicate a link between epigenetic modifications and CD7 expression in primitive chronic myeloid leukemia cells.
20046078 CD7 loss in aggressive natural killer-cell leukemia; a useful diagnostic marker
More...

AA Sequence

MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDII      1 - 70
YYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWH     71 - 140
RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCS    141 - 210
WRDKNSAACVVYEDMSHSRCNTLSSPNQYQ                                            211 - 240
//

Text Mined References (43)

PMID Year Title
25679063 2015 Correlation of FLT3 mutations with expression of CD7 in acute myeloid leukemia.
24920488 2014 CD7 promotes extramedullary involvement of the B-cell acute lymphoblastic leukemia line Tanoue by enhancing integrin ?2-dependent cell adhesiveness.
24727323 2014 CADM1 expression and stepwise downregulation of CD7 are closely associated with clonal expansion of HTLV-I-infected cells in adult T-cell leukemia/lymphoma.
24211252 2014 Autocrine GM-CSF transcription in the leukemic progenitor cell line KG1a is mediated by the transcription factor ETS1 and is negatively regulated through SECTM1 mediated ligation of CD7.
24157461 2014 SECTM1 produced by tumor cells attracts human monocytes via CD7-mediated activation of the PI3K pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20398252 2010 CD7 in acute myeloid leukemia: correlation with loss of wild-type CEBPA, consequence of epigenetic regulation.
20175919 2010 Expression of the leukemic prognostic marker CD7 is linked to epigenetic modifications in chronic myeloid leukemia.
20046078 2009 Frequent CD7 antigen loss in aggressive natural killer-cell leukemia: a useful diagnostic marker.
19937140 2009 Twist2 regulates CD7 expression and galectin-1-induced apoptosis in mature T-cells.
More...