Property Summary

NCBI Gene PubMed Count 40
PubMed Score 797.45
PubTator Score 532.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -1.020 4.0e-02
osteosarcoma -1.627 3.5e-06
psoriasis 2.000 2.3e-46
tuberculosis and treatment for 6 months -1.300 5.2e-05

Gene RIF (21)

AA Sequence

MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDII      1 - 70
YYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWH     71 - 140
RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCS    141 - 210
WRDKNSAACVVYEDMSHSRCNTLSSPNQYQ                                            211 - 240
//

Text Mined References (43)

PMID Year Title