Property Summary

NCBI Gene PubMed Count 74
PubMed Score 167.81
PubTator Score 276.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Autistic Disorder 364 3.34 1.7
Uterine Cervical Neoplasms 26 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.3e-85
lung carcinoma 2843 1.1e-14
osteosarcoma 7950 7.4e-08
pancreatic cancer 2398 8.2e-05
colon cancer 1478 1.6e-02
interstitial cystitis 2312 2.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Connective tissue disease 62 0.0 3.0
Crohn's disease 321 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 3.748 1.9
Frontotemporal dementia 51 3.178 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
colon cancer 1.300 1.6e-02
interstitial cystitis 1.500 2.1e-02
lung carcinoma -1.500 1.1e-14
osteosarcoma 1.929 7.4e-08
pancreatic cancer 1.300 8.2e-05
psoriasis -3.000 1.3e-85

Protein-protein Interaction (1)

Gene RIF (52)

AA Sequence

MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVA      1 - 70
EWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPK     71 - 140
KMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHG    141 - 210
VSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIR    211 - 280
DREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKA    281 - 350
PKNADWTTAT                                                                351 - 360
//

Text Mined References (75)

PMID Year Title