Property Summary

NCBI Gene PubMed Count 67
Grant Count 123
R01 Count 76
Funding $11,939,594.43
PubMed Score 155.55
PubTator Score 276.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.929 0.000
colon cancer 1.300 0.016
pancreatic cancer 1.300 0.000
interstitial cystitis 1.500 0.021
lung carcinoma -1.500 0.000
psoriasis -3.000 0.000

Synonym

Accession P09544 A4D0V1 Q75N05 Q9UDP9
Symbols IRP
INT1L1

Gene

PANTHER Protein Class (1)

Gene RIF (45)

PMID Text
26484565 Wnt2 complements Wnt/beta-catenin signaling in regulating colorectal cancer cell proliferation.
26116230 Wnt2/beta-catenin signaling was involved in stromal-epithelial cells interaction in endometriosis.
25731618 High expression of Wnt2 is associated with pancreatic cancer progression promoted by pancreatic stellate cells.
25472883 HIV-1 Tat specifically associates with WNT2 promoter to upregulate WNT2 expression in T cells
23815780 We demonstrated an activation of Wnt-2 signaling via the Frizzled-8 receptor in non-small cell lung cancer cells
23694962 Hypermethylation of WNT2 is associated with colorectal cancer.
23603171 The study demonistrated that expressions of Wnt-2 in high-grade brainstem gliomas were significantly higher than that in low-grade brainstem gliomas and normal brain tissues and were positively correlated with the expression of Ki-67.
23322712 Decreased placental expression of Wnt2 and increased placental expression of sFRP4 may be associated with the pathogenesis of severe preeclampsia.
23268410 The skin lesions of scleroderma patients showed obviously increased expression of cytoplasmic Wnt 2, nuclear Wnt 3a and beta-catenin, but markedly lowered cell membrane expression of beta-catenin than normal skin.
22949635 Pdgf signaling potentiates Wnt2-Wnt7b signaling to promote high levels of Wnt activity in mesenchymal progenitors that is required for proper development of endoderm-derived organs, such as the lung
More...

AA Sequence

MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVA      1 - 70
EWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPK     71 - 140
KMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHG    141 - 210
VSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIR    211 - 280
DREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKA    281 - 350
PKNADWTTAT                                                                351 - 360
//

Text Mined References (68)

PMID Year Title
26484565 2015 Wnt2 complements Wnt/?-catenin signaling in colorectal cancer.
26116230 2015 Metformin regulates stromal-epithelial cells communication via Wnt2/?-catenin signaling in endometriosis.
25731618 2015 Wnt2 protein plays a role in the progression of pancreatic cancer promoted by pancreatic stellate cells.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23815780 2013 Frizzled-8 receptor is activated by the Wnt-2 ligand in non-small cell lung cancer.
23694962 2013 DNA methylation biomarkers for noninvasive diagnosis of colorectal cancer.
23610556 2013 A positive feedback loop involving Gcm1 and Fzd5 directs chorionic branching morphogenesis in the placenta.
23603171 2013 The expressions of Wnt/?-catenin pathway-related components in brainstem gliomas.
23322712 2013 Association of Wnt2 and sFRP4 expression in the third trimester placenta in women with severe preeclampsia.
23268410 2012 [Role of Wnt 2, Wnt 3a and ?-catenin in skin lesions of patients with scleroderma].
More...