Property Summary

NCBI Gene PubMed Count 60
PubMed Score 110.42
PubTator Score 411.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
glioblastoma multiforme 347 1.19107255620053E-10
oligodendroglioma 2849 1.26830092780237E-7
atypical teratoid/rhabdoid tumor 1095 2.68518058806764E-6
ovarian cancer 8492 9.97669546461274E-6
osteosarcoma 7933 1.46493818716198E-4
psoriasis 6685 1.76032373838461E-4
sonic hedgehog group medulloblastoma 1482 1.78266505302456E-4
lung cancer 4473 5.07500051778534E-4
medulloblastoma, large-cell 6234 0.00111383015959908
subependymal giant cell astrocytoma 2287 0.0012730017158009
pediatric high grade glioma 2712 0.00160997729311733
Pick disease 1893 0.00753172062122714
ependymoma 2514 0.0157682075144514
astrocytic glioma 2241 0.0285066474051355
Disease Target Count
Smith-Magenis syndrome 3

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.400 0.029
ependymoma -2.200 0.016
psoriasis -1.200 0.000
glioblastoma multiforme -1.400 0.000
oligodendroglioma -1.300 0.000
osteosarcoma -2.006 0.000
sonic hedgehog group medulloblastoma -2.400 0.000
atypical teratoid/rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -1.500 0.001
lung cancer 1.400 0.001
pediatric high grade glioma -1.600 0.002
subependymal giant cell astrocytoma -3.568 0.001
Pick disease -1.100 0.008
ovarian cancer 1.700 0.000

Synonym

Accession P09543 CNP
Symbols CNP1

Gene

CNP

PANTHER Protein Class (2)

PDB

1WOJ  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Anole lizard OMA EggNOG

Gene RIF (35)

PMID Text
25930075 This study showed that the expression of CNPase protein was significantly decreased but increase expression mrna in ventral prefrontal white matter in major depressive disorder.
24808540 kidneys express 2',3'-cyclic nucleotide 3'-phosphodiesterase (CNPase), and renal CNPase mediates in part the renal 2',3'-cAMP-adenosine pathway
24260477 2',3'-cyclic nucleotide 3'-phosphodiesterases inhibit hepatitis B virus replication.
23084924 CNP binds to the structural protein Gag and blocks HIV-1 particle assembly after Gag and viral RNA have associated with the plasma membrane.
23084924 CNP targets the MA domain of the HIV-1 Gag protein following its association with the plasma membrane. CNP is packaged into the interior of virions and is resistant to digestion by subtilisin
23032943 Bipolar I disorder and schizophrenia ahare a number of common genetic risk loci and susceptibility genes including the genes coding for 2',3'-cyclic nucleotide 3' phosphodiesterase enzyme.
22954668 No Alzheimer disease-associated differences in CNP and DPYSL2 promoter DNA methylation were observed.
22589395 Differential CNP expression correlated with mouse model survival, and CNP immunoassay of a large GBM tissue microarray also showed significant differential patient survival
22473874 The characteristic features in both humans and mice with their partial CNP 'loss-of-function' genotype are best described as 'catatonia-depression' syndrome.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MNRGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLFILRGLPGSGKSTLARVI      1 - 70
VDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQ     71 - 140
YQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFL    141 - 210
EELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSK    211 - 280
AFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLE    281 - 350
ILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTI    351 - 420
I//

Text Mined References (66)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25930075 2015 Oligodendrocyte morphometry and expression of myelin - Related mRNA in ventral prefrontal white matter in major depressive disorder.
24808540 2014 Role of 2',3'-cyclic nucleotide 3'-phosphodiesterase in the renal 2',3'-cAMP-adenosine pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260477 2013 2',3'-cyclic nucleotide 3'-phosphodiesterases inhibit hepatitis B virus replication.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084924 2012 Inhibition of HIV-1 particle assembly by 2',3'-cyclic-nucleotide 3'-phosphodiesterase.
23032943 2012 The association of white matter volume in psychotic disorders with genotypic variation in NRG1, MOG and CNP: a voxel-based analysis in affected individuals and their unaffected relatives.
More...