Property Summary

NCBI Gene PubMed Count 60
PubMed Score 112.34
PubTator Score 411.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.400 2.9e-02
atypical teratoid / rhabdoid tumor -1.200 1.3e-04
ependymoma -2.200 1.6e-02
glioblastoma -1.200 4.5e-03
group 3 medulloblastoma -2.100 1.3e-02
lung cancer 1.400 5.1e-04
medulloblastoma, large-cell -1.300 6.4e-03
oligodendroglioma -1.300 1.3e-07
osteosarcoma -2.006 1.5e-04
ovarian cancer 1.500 5.5e-10
pediatric high grade glioma -1.600 1.6e-03
Pick disease -1.100 7.5e-03
psoriasis -1.200 1.8e-04
subependymal giant cell astrocytoma -3.568 1.3e-03

Protein-protein Interaction (1)

Gene RIF (35)

AA Sequence

MNRGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLFILRGLPGSGKSTLARVI      1 - 70
VDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQ     71 - 140
YQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFL    141 - 210
EELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSK    211 - 280
AFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLE    281 - 350
ILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTI    351 - 420
I//

Text Mined References (66)

PMID Year Title