Property Summary

NCBI Gene PubMed Count 60
Grant Count 34
R01 Count 4
Funding $4,787,070.5
PubMed Score 110.42
PubTator Score 411.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.400 0.029
ependymoma -2.200 0.016
psoriasis -1.200 0.000
glioblastoma multiforme -1.400 0.000
oligodendroglioma -1.300 0.000
osteosarcoma -2.006 0.000
sonic hedgehog group medulloblastoma -2.400 0.000
atypical teratoid/rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -1.500 0.001
lung cancer 1.400 0.001
pediatric high grade glioma -1.600 0.002
subependymal giant cell astrocytoma -3.568 0.001
Pick disease -1.100 0.008
ovarian cancer 1.700 0.000

Gene RIF (38)

PMID Text
25930075 This study showed that the expression of CNPase protein was significantly decreased but increase expression mrna in ventral prefrontal white matter in major depressive disorder.
24808540 kidneys express 2',3'-cyclic nucleotide 3'-phosphodiesterase (CNPase), and renal CNPase mediates in part the renal 2',3'-cAMP-adenosine pathway
24260477 2',3'-cyclic nucleotide 3'-phosphodiesterases inhibit hepatitis B virus replication.
23084924 CNP binds to the structural protein Gag and blocks HIV-1 particle assembly after Gag and viral RNA have associated with the plasma membrane.
23084924 CNP targets the MA domain of the HIV-1 Gag protein following its association with the plasma membrane. CNP is packaged into the interior of virions and is resistant to digestion by subtilisin
23084924 CNP targets the MA domain of the HIV-1 Gag protein following its association with the plasma membrane. CNP is packaged into the interior of virions and is resistant to digestion by subtilisin
23084924 CNP targets the MA domain of the HIV-1 Gag protein following its association with the plasma membrane. CNP is packaged into the interior of virions and is resistant to digestion by subtilisin
23084924 CNP targets the MA domain of the HIV-1 Gag protein following its association with the plasma membrane. CNP is packaged into the interior of virions and is resistant to digestion by subtilisin
23032943 Bipolar I disorder and schizophrenia ahare a number of common genetic risk loci and susceptibility genes including the genes coding for 2',3'-cyclic nucleotide 3' phosphodiesterase enzyme.
22954668 No Alzheimer disease-associated differences in CNP and DPYSL2 promoter DNA methylation were observed.
More...

AA Sequence

MNRGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLFILRGLPGSGKSTLARVI      1 - 70
VDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQ     71 - 140
YQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFL    141 - 210
EELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSK    211 - 280
AFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLE    281 - 350
ILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTI    351 - 420
I//

Text Mined References (66)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25930075 2015 Oligodendrocyte morphometry and expression of myelin - Related mRNA in ventral prefrontal white matter in major depressive disorder.
24808540 2014 Role of 2',3'-cyclic nucleotide 3'-phosphodiesterase in the renal 2',3'-cAMP-adenosine pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260477 2013 2',3'-cyclic nucleotide 3'-phosphodiesterases inhibit hepatitis B virus replication.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084924 2012 Inhibition of HIV-1 particle assembly by 2',3'-cyclic-nucleotide 3'-phosphodiesterase.
23032943 2012 The association of white matter volume in psychotic disorders with genotypic variation in NRG1, MOG and CNP: a voxel-based analysis in affected individuals and their unaffected relatives.
More...