Property Summary

NCBI Gene PubMed Count 108
PubMed Score 28.32
PubTator Score 38.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.046 1.3e-04
Breast cancer 1.400 3.4e-02
breast carcinoma -1.500 6.8e-05
chronic rhinosinusitis -1.403 7.9e-03
cystic fibrosis and chronic rhinosinusit... -1.090 3.8e-02
ductal carcinoma in situ -1.100 2.6e-02
ependymoma 1.500 2.2e-05
facioscapulohumeral dystrophy -2.200 7.0e-04
group 3 medulloblastoma 1.900 1.5e-03
invasive ductal carcinoma -1.400 9.5e-04
lung cancer 1.900 5.1e-05
ovarian cancer 1.800 4.3e-04
Pick disease 1.100 4.3e-03
pituitary cancer -1.700 1.2e-04
psoriasis -1.200 2.1e-05

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (79)

AA Sequence

MDGLPGRALGAACLLLLAAGWLGPEAWGSPTPPPTPAAPPPPPPPGSPGGSQDTCTSCGGFRRPEELGRV      1 - 70
DGDFLEAVKRHILSRLQMRGRPNITHAVPKAAMVTALRKLHAGKVREDGRVEIPHLDGHASPGADGQERV     71 - 140
SEIISFAETDGLASSRVRLYFFISNEGNQNLFVVQASLWLYLKLLPYVLEKGSRRKVRVKVYFQEQGHGD    141 - 210
RWNMVEKRVDLKRSGWHTFPLTEAIQALFERGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQA    211 - 280
RLGDSRHRIRKRGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSF    281 - 350
HTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA                 351 - 407
//

Text Mined References (109)

PMID Year Title