Property Summary

NCBI Gene PubMed Count 104
PubMed Score 25.38
PubTator Score 38.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 2.15858984797725E-8
ependymoma 2514 2.22454520128336E-5
lung cancer 4473 5.05514949646615E-5
breast carcinoma 1614 5.85726239568053E-5
pituitary cancer 1972 1.21758245649068E-4
acute quadriplegic myopathy 1157 1.29604119184606E-4
Breast cancer 3099 2.1953585890824E-4
ovarian cancer 8492 4.3108357813996E-4
facioscapulohumeral dystrophy 286 6.98231713332903E-4
invasive ductal carcinoma 2950 9.51817974620855E-4
group 3 medulloblastoma 2254 0.00151059861934235
Pick disease 1893 0.00434173312823767
chronic rhinosinusitis 512 0.00789494759588719
ductal carcinoma in situ 1745 0.0261310376210672
cystic fibrosis and chronic rhinosinusitis 213 0.0380444858137342
Disease Target Count Z-score Confidence
Obesity 616 0.0 2.0

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -1.500 0.000
ependymoma 1.500 0.000
acute quadriplegic myopathy 1.046 0.000
lung cancer 1.900 0.000
breast carcinoma -1.700 0.000
group 3 medulloblastoma 1.900 0.002
Breast cancer -2.100 0.000
Pick disease 1.100 0.004
ductal carcinoma in situ -1.100 0.026
invasive ductal carcinoma -1.400 0.001
ovarian cancer 1.800 0.000
pituitary cancer -1.700 0.000
chronic rhinosinusitis -1.403 0.008
cystic fibrosis and chronic rhinosinusit... -1.090 0.038
facioscapulohumeral dystrophy -2.200 0.001

Synonym

Accession P09529 Q53T31 Q8N1D3
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (75)

PMID Text
26452703 The Sertoli cell hormones inhibin-B and anti Mullerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
26313529 Pregnant Han Chinese women carrying the rs7579169 CC genotype and G-G-C haplotype are significantly more likely to develop pre-eclampsia, especially late-onset and multiparous cases.
25581422 inhibin B and anti-Mullerian hormone serum concentrations did not provide an additional diagnostic tool for male infertility
25557874 Activin-A and -B are abundantly expressed in mesothelioma tumor tissue.
25361680 We report here an original observation that activin-B is upregulated in the human idiopathic pulmonary fibrosis lung.
25343250 reduction of RhoA signaling by Activin B together with persistent Rac1 activity is a prerequisite for inducing an invasive phenotype in clear cell renal cell carcinoma.
25062451 Activin A, B, and AB have similar effects on steroidogenesis in human granulosa cells; in contrast, activin AC is not biologically active and does not act as a competitive antagonist.
24599287 Serum inhibin levels correlate with clinical characteristics and mortality in epithelial ovarian cancer patients.
24378873 Data show that expression of activin A and B was increased in many cancer cell lines.
24188875 Inhibin B production was decreased following recombinant human chorionic gonadotropin administration in both control and polycystic ovary syndrome women.
More...

AA Sequence

MDGLPGRALGAACLLLLAAGWLGPEAWGSPTPPPTPAAPPPPPPPGSPGGSQDTCTSCGGFRRPEELGRV      1 - 70
DGDFLEAVKRHILSRLQMRGRPNITHAVPKAAMVTALRKLHAGKVREDGRVEIPHLDGHASPGADGQERV     71 - 140
SEIISFAETDGLASSRVRLYFFISNEGNQNLFVVQASLWLYLKLLPYVLEKGSRRKVRVKVYFQEQGHGD    141 - 210
RWNMVEKRVDLKRSGWHTFPLTEAIQALFERGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQA    211 - 280
RLGDSRHRIRKRGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSF    281 - 350
HTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA                 351 - 407
//

Text Mined References (105)

PMID Year Title
26452703 2016 The Sertoli cell hormones inhibin-B and anti Müllerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
26313529 2015 Single nucleotide polymorphisms near the inhibin beta B gene on 2q14 are associated with pre-eclampsia in Han Chinese women.
25581422 2015 Inhibin B is lower and anti-Müllerian hormone is similar in serum of men with spinal cord injuries compared to controls.
25557874 2015 Overexpression of activin-A and -B in malignant mesothelioma - attenuated Smad3 signaling responses and ERK activation promote cell migration and invasive growth.
25528498 2015 Evaluating the ovarian cancer gonadotropin hypothesis: a candidate gene study.
25361680 2014 Upregulation of activin-B and follistatin in pulmonary fibrosis - a translational study using human biopsies and a specific inhibitor in mouse fibrosis models.
25343250 2014 Activin B antagonizes RhoA signaling to stimulate mesenchymal morphology and invasiveness of clear cell renal cell carcinomas.
25062451 2014 Effects of recombinant activins on steroidogenesis in human granulosa-lutein cells.
24599287 2014 Serum inhibin A and inhibin B levels in epithelial ovarian cancer patients.
24378873 2014 Elevated expression of activins promotes muscle wasting and cachexia.
More...