Property Summary

NCBI Gene PubMed Count 104
PubMed Score 25.38
PubTator Score 38.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -1.500 0.000
ependymoma 1.500 0.000
acute quadriplegic myopathy 1.046 0.000
lung cancer 1.900 0.000
breast carcinoma -1.700 0.000
group 3 medulloblastoma 1.900 0.002
Breast cancer -2.100 0.000
Pick disease 1.100 0.004
ductal carcinoma in situ -1.100 0.026
invasive ductal carcinoma -1.400 0.001
ovarian cancer 1.800 0.000
pituitary cancer -1.700 0.000
chronic rhinosinusitis -1.403 0.008
cystic fibrosis and chronic rhinosinusit... -1.090 0.038
facioscapulohumeral dystrophy -2.200 0.001

Synonym

Accession P09529 Q53T31 Q8N1D3
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (75)

PMID Text
26452703 The Sertoli cell hormones inhibin-B and anti Mullerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
26313529 Pregnant Han Chinese women carrying the rs7579169 CC genotype and G-G-C haplotype are significantly more likely to develop pre-eclampsia, especially late-onset and multiparous cases.
25581422 inhibin B and anti-Mullerian hormone serum concentrations did not provide an additional diagnostic tool for male infertility
25557874 Activin-A and -B are abundantly expressed in mesothelioma tumor tissue.
25361680 We report here an original observation that activin-B is upregulated in the human idiopathic pulmonary fibrosis lung.
25343250 reduction of RhoA signaling by Activin B together with persistent Rac1 activity is a prerequisite for inducing an invasive phenotype in clear cell renal cell carcinoma.
25062451 Activin A, B, and AB have similar effects on steroidogenesis in human granulosa cells; in contrast, activin AC is not biologically active and does not act as a competitive antagonist.
24599287 Serum inhibin levels correlate with clinical characteristics and mortality in epithelial ovarian cancer patients.
24378873 Data show that expression of activin A and B was increased in many cancer cell lines.
24188875 Inhibin B production was decreased following recombinant human chorionic gonadotropin administration in both control and polycystic ovary syndrome women.
More...

AA Sequence

MDGLPGRALGAACLLLLAAGWLGPEAWGSPTPPPTPAAPPPPPPPGSPGGSQDTCTSCGGFRRPEELGRV      1 - 70
DGDFLEAVKRHILSRLQMRGRPNITHAVPKAAMVTALRKLHAGKVREDGRVEIPHLDGHASPGADGQERV     71 - 140
SEIISFAETDGLASSRVRLYFFISNEGNQNLFVVQASLWLYLKLLPYVLEKGSRRKVRVKVYFQEQGHGD    141 - 210
RWNMVEKRVDLKRSGWHTFPLTEAIQALFERGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQA    211 - 280
RLGDSRHRIRKRGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSF    281 - 350
HTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA                 351 - 407
//

Text Mined References (105)

PMID Year Title
26452703 2016 The Sertoli cell hormones inhibin-B and anti Müllerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
26313529 2015 Single nucleotide polymorphisms near the inhibin beta B gene on 2q14 are associated with pre-eclampsia in Han Chinese women.
25581422 2015 Inhibin B is lower and anti-Müllerian hormone is similar in serum of men with spinal cord injuries compared to controls.
25557874 2015 Overexpression of activin-A and -B in malignant mesothelioma - attenuated Smad3 signaling responses and ERK activation promote cell migration and invasive growth.
25528498 2015 Evaluating the ovarian cancer gonadotropin hypothesis: a candidate gene study.
25361680 2014 Upregulation of activin-B and follistatin in pulmonary fibrosis - a translational study using human biopsies and a specific inhibitor in mouse fibrosis models.
25343250 2014 Activin B antagonizes RhoA signaling to stimulate mesenchymal morphology and invasiveness of clear cell renal cell carcinomas.
25062451 2014 Effects of recombinant activins on steroidogenesis in human granulosa-lutein cells.
24599287 2014 Serum inhibin A and inhibin B levels in epithelial ovarian cancer patients.
24378873 2014 Elevated expression of activins promotes muscle wasting and cachexia.
More...