Property Summary

NCBI Gene PubMed Count 61
Grant Count 15
R01 Count 9
Funding $1,262,511.3
PubMed Score 149.18
PubTator Score 108.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Chronic Lymphocytic Leukemia -1.583 0.003
malignant mesothelioma -3.100 0.000
Barrett's esophagus 1.200 0.023
esophageal adenocarcinoma 1.900 0.027
psoriasis 1.300 0.000
ependymoma 2.000 0.000
glioblastoma 1.500 0.002
atypical teratoid / rhabdoid tumor 1.200 0.009
Duchenne muscular dystrophy 1.181 0.000
autosomal dominant Emery-Dreifuss muscul... 1.014 0.010
juvenile dermatomyositis 1.299 0.000
acute quadriplegic myopathy 1.809 0.000
tuberculosis 3.400 0.000
non-small cell lung cancer -1.157 0.000
lung cancer -2.100 0.000
Breast cancer 3.100 0.030
lung carcinoma -2.000 0.000
ovarian cancer 3.200 0.000
dermatomyositis 1.300 0.007

Gene RIF (26)

PMID Text
26048190 role of annexin A4 in cancer
26023182 these results suggest that AnxA4 is a novel direct negative regulator of AC5, adding a new facet to the functions of annexins.
25633807 Data shows that CYTB and ANXA4 overexpression may be involved in carcinogenesis and histopathological differentiation of ovarian clear cell carcinoma and suggest they may serve as a potential diagnostic biomarkers.
25277200 These findings indicate that the calcium-binding site in the ANXA4 repeat induces chemoresistance to the platinum-based drug by elevating the intracellular chloride concentration.
24223161 Fhit delocalizes annexin A4 from plasma membrane to cytosol and sensitizes lung cancer cells to paclitaxel.
24150977 enhanced expression of Anx A4 confers platinum resistance by promoting efflux of platinum drugs via ATP7A.
23290009 This study showed that overexpression and nuclear localization of annexin A4 are related to chemoresistance and poor survival in patients with serous papillary ovarian carcinomas.
22970268 suggest that ANXA4 triggers a signaling cascade, leading to increased epithelial cell proliferation, ultimately promoting carcinogenesis
22883517 Lower expression of annexin A4 during window of implantation in infertile patients with endometriosis might be associated with the decrease of endometrial receptivity.
22847161 Eight ANXA4 polymorphisms are significantly associated with the risk of aspirin-exacerbated respiratory disease.
More...

AA Sequence

MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKS      1 - 70
ELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDI     71 - 140
RSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFD    141 - 210
EYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDM    211 - 280
LDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD                                   281 - 319
//

Text Mined References (67)

PMID Year Title
26048190 2015 Annexin A4 and cancer.
26023182 2015 Annexin A4 is a novel direct regulator of adenylyl cyclase type 5.
25633807 2015 Cystatin B as a potential diagnostic biomarker in ovarian clear cell carcinoma.
25277200 2014 Annexin A4 induces platinum resistance in a chloride-and calcium-dependent manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223161 2013 Fhit delocalizes annexin a4 from plasma membrane to cytosol and sensitizes lung cancer cells to paclitaxel.
24150977 2014 Annexin A4-conferred platinum resistance is mediated by the copper transporter ATP7A.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
More...