Property Summary

NCBI Gene PubMed Count 26
PubMed Score 193.56
PubTator Score 66.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.300 2.5e-05
astrocytic glioma -1.400 1.1e-03
atypical teratoid / rhabdoid tumor -1.100 9.9e-08
ependymoma -1.300 7.9e-03
esophageal adenocarcinoma -1.100 3.4e-02
glioblastoma -1.200 6.3e-04
intraductal papillary-mucinous adenoma (... 1.900 7.6e-05
intraductal papillary-mucinous carcinoma... 1.100 2.1e-03
lung cancer -1.300 6.8e-04
medulloblastoma, large-cell -1.200 3.5e-05
Multiple myeloma 1.090 1.3e-03
ovarian cancer -1.400 8.0e-07
pancreatic cancer 1.300 5.8e-05
primary pancreatic ductal adenocarcinoma 1.133 4.5e-02
psoriasis -1.600 1.5e-04
sonic hedgehog group medulloblastoma -1.100 2.6e-05
spina bifida -1.354 4.1e-02

 GWAS Trait (1)

Gene RIF (18)

AA Sequence

MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGT      1 - 70
TVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWN     71 - 140
QRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCK    141 - 210
DVSRLRSVLMSLKQTPLSR                                                       211 - 229
//

Text Mined References (29)

PMID Year Title