Property Summary

NCBI Gene PubMed Count 33
PubMed Score 15.14
PubTator Score 30.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.327 0.017
Multiple myeloma 1.356 0.008
psoriasis 1.900 0.000
osteosarcoma -2.326 0.000
acute quadriplegic myopathy 1.155 0.000
adrenocortical carcinoma 1.177 0.016
active Crohn's disease -1.246 0.008
non primary Sjogren syndrome sicca -1.300 0.021
Breast cancer -1.100 0.000
ovarian cancer 2.500 0.000
pituitary cancer 1.300 0.031

Synonym

Accession P09496 A8K4W3 B4DIN1 F5H6N3 Q2XPN5 Q53XZ1 Lca
Symbols LCA

Gene

Gene RIF (29)

PMID Text
26975582 Data indicate that clathrin-mediated endocytosis of proto-oncogene protein erbB-3 (ErbB3) is depending on epsin-1.
23460120 Upon receptor activation, prostate alpha1A-adrenoceptors bind clathrin LCA.
23304142 HIV-1 matrix and gp120 co-localize with clathrin in primary T lymphocytes
21738476 HIV-1 matrix and gp120 co-localize with clathrin in primary T lymphocytes
21738476 HIV-1 matrix and gp120 co-localize with clathrin in primary T lymphocytes
21738476 HIV-1 matrix and gp120 co-localize with clathrin in primary T lymphocytes
21738476 HIV-1 matrix and gp120 co-localize with clathrin in primary T lymphocytes
21738476 HIV-1 matrix and gp120 co-localize with clathrin in primary T lymphocytes
21704113 HIV-1 matrix and gp120 co-localize with clathrin in primary T lymphocytes
21611203 IGF1R internalization and co-localization with clathrin and CAV1 upon ligand binding, as well as the status of the IGF1R pathway, cellular proliferation, and the apoptosis of interfered and inhibited Ewing's sarcoma, were analyzed.
More...

AA Sequence

MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPG      1 - 70
GPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAI     71 - 140
KELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTE    141 - 210
WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH                                    211 - 248
//

Text Mined References (44)

PMID Year Title
26975582 2016 Interaction with epsin 1 regulates the constitutive clathrin-dependent internalization of ErbB3.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23460120 2013 Noradrenaline induces binding of Clathrin light chain A to ?1-adrenoceptors in the human prostate.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
21611203 2011 IGF1R signaling in Ewing sarcoma is shaped by clathrin-/caveolin-dependent endocytosis.
21297582 2011 A TACC3/ch-TOG/clathrin complex stabilises kinetochore fibres by inter-microtubule bridging.
21269460 2011 Initial characterization of the human central proteome.
21203429 2010 Ligand-induced tyrosine phosphorylation of cysteinyl leukotriene receptor 1 triggers internalization and signaling in intestinal epithelial cells.
More...