Property Summary

NCBI Gene PubMed Count 35
PubMed Score 16.00
PubTator Score 30.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease -1.246 8.5e-03
acute quadriplegic myopathy 1.155 7.5e-09
adrenocortical carcinoma 1.177 1.6e-02
Breast cancer -1.100 1.4e-04
Multiple myeloma 1.072 2.7e-02
non primary Sjogren syndrome sicca -1.300 2.1e-02
osteosarcoma -2.326 4.1e-06
ovarian cancer -1.100 3.7e-04
pituitary cancer 1.300 3.1e-02
psoriasis 1.200 2.5e-04
Waldenstrons macroglobulinemia 1.203 6.7e-03

Gene RIF (21)

AA Sequence

MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPG      1 - 70
GPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAI     71 - 140
KELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTE    141 - 210
WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH                                    211 - 248
//

Text Mined References (46)

PMID Year Title