Property Summary

NCBI Gene PubMed Count 153
PubMed Score 154.34
PubTator Score 43.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0
Orofacial cleft 54 0.0 1.8
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 56 4.35 2.2
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Disease Target Count Z-score Confidence
Ebstein anomaly 16 3.257 1.6

Expression

  Differential Expression (22)

Disease log2 FC p
acute myeloid leukemia -1.200 3.5e-02
acute quadriplegic myopathy -1.033 1.4e-03
Atopic dermatitis -1.300 1.2e-03
atypical teratoid / rhabdoid tumor 1.400 7.1e-03
autosomal dominant Emery-Dreifuss muscul... 1.067 3.1e-02
Breast cancer -1.100 9.1e-06
colon cancer -1.200 2.4e-02
cystic fibrosis -1.222 6.7e-05
dermatomyositis 2.200 1.3e-02
Duchenne muscular dystrophy 1.190 9.5e-05
fibroadenoma 1.100 5.0e-02
gastric cancer 1.200 1.4e-03
glioblastoma 1.300 2.3e-02
group 3 medulloblastoma 1.100 3.3e-02
intraductal papillary-mucinous adenoma (... -1.200 1.9e-02
malignant mesothelioma -1.500 2.5e-06
medulloblastoma, large-cell -1.500 9.9e-05
ovarian cancer -3.100 2.2e-11
pancreatic cancer 1.500 1.8e-03
pancreatic carcinoma 1.500 1.8e-03
pancreatic ductal adenocarcinoma liver m... 2.456 1.7e-02
psoriasis -1.600 2.1e-04

Gene RIF (101)

AA Sequence

MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEK      1 - 70
LELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEK     71 - 140
MEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQ    141 - 210
AEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALND    211 - 280
MTSI                                                                      281 - 284
//

Text Mined References (160)

PMID Year Title