Property Summary

NCBI Gene PubMed Count 136
Grant Count 6
R01 Count 2
Funding $835,674.21
PubMed Score 139.72
PubTator Score 43.52

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (85)

PMID Text
26873245 The mutation reduced binding affinity for both Lmod2 and Tmod1. The effect of the K15N mutation on Tpm1.1 binding to Lmod2 and Tmod1 provides a molecular rationale for the development of familial dilated cardiomyopathies .
26400351 The TPM1 (rs1071646) and TNNT2 (rs3729547) gene variants might represent risk factors for patients with dilated cardiomyopathy in the Kazakh population.
26200873 Data confirm that the substitutions of the Tpm1 residues G126 and D137 with the canonical ones, Arg and Leu, respectively, increase the stiffness of the Tpm coiled-coil
25873252 these results indicate that TPM1 may be one mechanism underlying radiation resistance, and TPM1 may be a potential target for overcoming the radiation resistance in glioma.
25607779 Coexistence of Digenic Mutations in Both TPM1 and MYH7 Genes Leads to Severe Hypertrophic Cardiomyopathy.
25607530 TPM1 exhibits characteristics of a tumor-suppressor gene while being overexpressed in Renal cell carcinoma cell lines.
25548289 Mutant TPM1cause m ultiple functional alterations in actin affinity and Ca2+ sensitivity.
25408381 Mitochondrial RNA induces tropomyosin synthesis.
25241052 cardiomyopathy-associated E62Q tropomyosin mutation weakens actin-tropomyosin interaction, but phosphorylation of neighboring S61 rescues the binding-deficit, results confirmed experimentally by in vitro motility assays.
24958154 We have quantified the expression of the total sarcomeric TPM1 and observed a 1.5-fold increase in treated cells.
More...

AA Sequence

MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEK      1 - 70
LELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEK     71 - 140
MEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQ    141 - 210
AEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALND    211 - 280
MTSI                                                                      281 - 284
//

Text Mined References (142)

PMID Year Title
26873245 2016 Localization of the binding interface between leiomodin-2 and ?-tropomyosin.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26400351 2015 Significance of sarcomere gene mutation in patients with dilated cardiomyopathy.
26200873 2015 Stabilizing the central part of tropomyosin increases the bending stiffness of the thin filament.
25873252 2015 Silencing of the TPM1 gene induces radioresistance of glioma U251 cells.
25607779 2015 Coexistence of Digenic Mutations in Both Thin (TPM1) and Thick (MYH7) Filaments of Sarcomeric Genes Leads to Severe Hypertrophic Cardiomyopathy in a South Indian FHCM.
25607530 2015 Clinical and tumor significance of tropomyosin-1 expression levels in renal cell carcinoma.
25548289 2015 Mechanistic heterogeneity in contractile properties of ?-tropomyosin (TPM1) mutants associated with inherited cardiomyopathies.
25416956 2014 A proteome-scale map of the human interactome network.
25408381 2015 Identification of a human mitochondrial RNA that promotes tropomyosin synthesis and myocardial differentiation.
More...