Property Summary

NCBI Gene PubMed Count 2,051
PubMed Score 1991.14
PubTator Score 2114.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (2475)

AA Sequence

MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI      1 - 70
TQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSE     71 - 140
FLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFS    141 - 210
KMAVWGNK                                                                  211 - 218
//

Text Mined References (2053)

PMID Year Title