Property Summary

NCBI Gene PubMed Count 1,965
Grant Count 372
R01 Count 201
Funding $42,360,961.36
PubMed Score 1954.91
PubTator Score 2114.63

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P09488 Q5GHG0 Q6FH88 Q8TC98 Q9UC96
Symbols MU
H-B
GST1
GTH4
GTM1
MU-1
GSTM1-1
GSTM1a-1a
GSTM1b-1b

Gene

PDB

1GTU   1XW6   1XWK   1YJ6   2F3M  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1324 confirmatory 19 / 0 / 815 Profiling Assay to determine GST-GSH interactions in multiplex bead-based assays (HPSMTB buffer)
1769 confirmatory 186 / 0 / 947 Profiling Assay to determine GST-GSH interactions in multiplex bead-based assays
602137 other 0 / 0 / 31 Counter screen to determine effect of SAR compounds for Rab7 project on GST-GSH binding, round 1
602145 other 0 / 0 / 12 Counter screen to determine effect of SAR compounds for Rab7 project on GST-GSH binding, round 2

Gene RIF (2389)

PMID Text
27090234 Data show a combined role of cytochrome P 450 1A1 (CYP1A1), Glutathione -S -transferase M1 (GSTM1) and T1 (GSTT1) polymorphisms and smoking status can be attributed for the cause of lung cancer.
27002825 The study showed that polymorphims of the GSTM1 and GSTP1 could impact remission and adverse drug reactions in lupus nephritis treated with cyclophosphamide
26937962 Thus these findings suggest that the three variants of ADH1C, MnSOD and GSTM1 can be used to identify individuals who are at high risk to develop ALD and may be helpful in proper management of Indian alcoholics
26909940 The GSTM1 null genotype has an impact on the increased risk of colorectal carcinoma in Saudi Arabia.
26823865 we suggest that the GSTM1 null genotype and GSTT1 null genotype are correlated with an increased risk of gestational diabetes mellitus in a Chinese population.
26782562 CYP1A1 and GSTM1 gene polymorphisms affect familial aggregation of esophageal cancer among the Kazakh ethnic group in Xinjiang.
26782535 In a subgroup analysis, only the null GSTM1 genotype was observed at a significantly higher frequency in Caucasian varicocele patients. (Meta-analysis)
26782376 The null or present polymorphism of GSTM1 and GSTT1 genes and Arg/Pro of the p53 gene were analyzed.
26681006 The frequency of the absence of the GSTM1 homozygous genotype in the bone tumor patients was markedly higher than that in the control.
26663067 Data suggest that the combined genotypes of glutathionine S-transferase GSTM1 (-/-), GSTT1 (+/+), GSTP1 (AA) and meiotic recombination protein SPO11 (CT) may be associated with idiopathic male infertility in ethnic Han Chinese.
More...

AA Sequence

MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI      1 - 70
TQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSE     71 - 140
FLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFS    141 - 210
KMAVWGNK                                                                  211 - 218
//

Text Mined References (1967)

PMID Year Title
27090234 2016 Association of CYP1A1, GSTM1 and GSTT1 gene polymorphisms with risk of non-small cell lung cancer in Andhra Pradesh region of South India.
27002825 2016 Glutathione S Transferases Polymorphisms Are Independent Prognostic Factors in Lupus Nephritis Treated with Cyclophosphamide.
26937962 2016 Genetic Association and Gene-Gene Interaction Reveal Genetic Variations in ADH1B, GSTM1 and MnSOD Independently Confer Risk to Alcoholic Liver Diseases in India.
26909940 2016 GSTM1 gene polymorphism and the risk of colorectal cancer in a Saudi Arabian population.
26823865 2015 Association of GSTs polymorphisms with risk of gestational diabetes mellitus.
26782562 2015 Correlation of CYP1A1 and GSTM1 gene polymorphisms and environmental factors to familial aggregation of esophageal cancer among the Kazakh ethnic group in Xinjiang.
26782535 2015 Glutathione S-transferase polymorphisms in varicocele patients: a meta-analysis.
26782376 2015 Polymorphisms of GSTM1, GSTT1, and p53 in Goiânia, Goiás.
26681006 2015 Effect of CYP1A1 and GSTM1 genetic polymorphisms on bone tumor susceptibility.
26663067 2015 [Association of SPO11 and GST gene polymorphisms with idiopathic male infertility in ethnic Han Chinese].
More...