Property Summary

NCBI Gene PubMed Count 2,051
PubMed Score 1991.14
PubTator Score 2114.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Synonym

Accession P09488 Q5GHG0 Q6FH88 Q8TC98 Q9UC96
Symbols MU
H-B
GST1
GTH4
GTM1
MU-1
GSTM1-1
GSTM1a-1a
GSTM1b-1b

Gene

PDB

1GTU   1XW6   1XWK   1YJ6   2F3M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2475)

AA Sequence

MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI      1 - 70
TQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSE     71 - 140
FLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFS    141 - 210
KMAVWGNK                                                                  211 - 218
//

Text Mined References (2053)

PMID Year Title