Property Summary

NCBI Gene PubMed Count 265
PubMed Score 1136.10
PubTator Score 714.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 4.703 2.4
Lateral cystocele 1 4.071 2.0
Osteoblastoma 8 3.327 1.7

Expression

  Differential Expression (38)

Disease log2 FC p
acute myeloid leukemia -1.900 5.7e-03
adult high grade glioma 1.200 2.5e-03
astrocytic glioma 1.900 2.4e-02
Astrocytoma, Pilocytic 2.000 1.5e-08
Atopic dermatitis -1.200 3.5e-03
atypical teratoid / rhabdoid tumor 1.400 9.4e-06
autosomal dominant Emery-Dreifuss muscul... 1.353 2.8e-02
Becker muscular dystrophy 1.410 1.2e-02
Breast cancer 1.400 5.3e-05
chronic kidney disease 1.400 3.6e-02
cystic fibrosis 2.300 1.4e-04
Down syndrome 1.200 9.0e-04
Duchenne muscular dystrophy 2.130 4.5e-08
ependymoma 1.300 3.2e-09
esophageal adenocarcinoma 1.400 2.3e-02
gastric cancer 1.500 2.1e-03
glioblastoma 1.400 3.3e-08
group 4 medulloblastoma -1.600 5.4e-04
hepatocellular carcinoma 1.200 3.0e-03
intraductal papillary-mucinous adenoma (... -2.700 3.1e-03
intraductal papillary-mucinous carcinoma... -2.300 2.7e-02
intraductal papillary-mucinous neoplasm ... -2.700 4.5e-02
invasive ductal carcinoma -1.500 2.1e-03
juvenile dermatomyositis 1.463 5.9e-09
limb girdle muscular dystrophy 2A 1.467 8.1e-05
medulloblastoma, large-cell -1.400 5.7e-04
nasopharyngeal carcinoma 1.900 4.8e-06
non primary Sjogren syndrome sicca 1.100 2.6e-02
oligodendroglioma 2.800 8.8e-03
ovarian cancer -2.300 6.4e-04
pancreatic cancer 2.200 2.3e-04
pancreatic carcinoma 2.200 2.3e-04
primary pancreatic ductal adenocarcinoma 3.963 8.6e-05
primitive neuroectodermal tumor 1.100 5.6e-03
pterygium 1.300 2.2e-02
subependymal giant cell astrocytoma 1.551 3.8e-02
ulcerative colitis 2.800 2.3e-05
urothelial carcinoma 3.900 1.4e-12

Protein-protein Interaction (1)

Gene RIF (217)

AA Sequence

MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAEN      1 - 70
PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHK     71 - 140
LHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGD    141 - 210
HPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKY    211 - 280
IALDEWAGCFGIKQKDIDKDLVI                                                   281 - 303
//

Text Mined References (267)

PMID Year Title