Property Summary

NCBI Gene PubMed Count 252
Grant Count 172
R01 Count 103
Funding $16,578,119.2
PubMed Score 1078.87
PubTator Score 714.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (62)

Disease Z-score Confidence
Cancer 2,346 4.618 2.3
Lateral cystocele 1 4.074 2.0
Osteoporosis 257 3.896 1.9
Osteogenesis imperfecta 34 3.41 1.7
Osteoblastoma 8 3.373 1.7
Atopic dermatitis 944
Becker muscular dystrophy 187
Colonic Neoplasms 126
Colorectal Neoplasms 217
Down syndrome 548
Duchenne muscular dystrophy 602
Hepatitis 61
Hyperalgesia 71
Intervertebral Disc Degeneration 5
Kidney Diseases 86
Leukemia, Myelocytic, Acute 113
Liver Cirrhosis 101
Liver Cirrhosis, Experimental 108
Low Back Pain 2
Multiple myeloma 1,327
Myocardial Ischemia 169
Necrosis 51
Neoplasms, Experimental 33
Osteogenesis imperfecta type IV (disorde... 10 
Uremia 19
Weight Gain 87
acute myeloid leukemia 780
adrenocortical carcinoma 1,427
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
chronic kidney disease 90
cystic fibrosis 1,665
esophageal adenocarcinoma 737
gastric carcinoma 832
glioblastoma 5,572
group 4 medulloblastoma 1,875
hepatocellular carcinoma 532
inflammatory breast cancer 404
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
oligodendroglioma 2,849
ovarian cancer 8,484
ovarian neoplasm 97
pancreatic cancer 2,300
pancreatic carcinoma 567
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
pterygium 74
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

Synonym

Accession P09486 D3DQH9 Q6IBK4
Symbols ON
OI17
BM-40

Gene

PDB

2V53   1BMO   1NUB   1SRA  

Gene RIF (207)

PMID Text
27069189 We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases.
26731428 SPARC might be an unfavorable indicator in patients with pancreatic cancer, especially in the stroma.[Review]
26656750 tracheal aspirate SPARC levels predicted development of bronchopulmonary dysplasia or death.
26523779 high SPARC-expression was a significant predictor of poor OS in HPV-negative OPSCC patients using Kaplan-Meier analysis and the log-rank test
26335014 Studies indicate that SPARC (secreted protein acidic and rich in cysteine) gene is involved in the development and progression of pancreatic ductal adenocarcinoma (PDAC).
26329007 CD90 is upregulated in gastric cancer and inhibits gastric cancer cell apoptosis by modulating the expression level of SPARC protein.
26169969 SPARC levels were not associated with efficacy in patients with MPC. This exploratory analysis does not support making treatment decisions regarding nab-paclitaxel plus gemcitabine or gemcitabine alone in MPC based on SPARC expression.
26165695 MLKL upregulation in SPARC overexpressed cells treated with Ara-C, indicates necrosis as a possible cell death process for the SKM-1 cells under these stringent conditions.
26044224 Reduced expression of SPARC in colorectal cancer tissue is associated with poor prognosis and aggressive clinicopathological features.
26027498 Recessive osteogenesis imperfecta caused by missense mutations in SPARC.
More...

AA Sequence

MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAEN      1 - 70
PCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHK     71 - 140
LHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGD    141 - 210
HPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKY    211 - 280
IALDEWAGCFGIKQKDIDKDLVI                                                   281 - 303
//

Text Mined References (254)

PMID Year Title
27069189 2016 Testing of a Novel Cancer Metastatic Multiplex Panel for the Detection of Bone-metastatic Disease - a Pilot Study.
26731428 2016 Prognostic Value of SPARC in Patients with Pancreatic Cancer: A Systematic Review and Meta-Analysis.
26656750 2015 Tracheal Aspirate Levels of the Matricellular Protein SPARC Predict Development of Bronchopulmonary Dysplasia.
26523779 2016 Expression of secreted protein acidic and rich in cysteine is an independent prognostic indicator of a poor clinical outcome in oropharyngeal carcinoma patients.
26335014 2015 SPARC: A Potential Prognostic and Therapeutic Target in Pancreatic Cancer.
26329007 2015 CD90 is upregulated in gastric cancer tissues and inhibits gastric cancer cell apoptosis by modulating the expression level of SPARC protein.
26169969 2015 SPARC Expression Did Not Predict Efficacy of nab-Paclitaxel plus Gemcitabine or Gemcitabine Alone for Metastatic Pancreatic Cancer in an Exploratory Analysis of the Phase III MPACT Trial.
26165695 2015 SPARC ectopic overexpression inhibits growth and promotes programmed cell death in acute myeloid leukemia transformed from myelodysplastic syndrome cells, alone and in combination with Ara-C treatment.
26044224 2015 Secreted protein acidic and rich in cysteine expression in human colorectal cancer predicts postoperative prognosis.
26027498 2015 Recessive osteogenesis imperfecta caused by missense mutations in SPARC.
More...