Property Summary

NCBI Gene PubMed Count 71
PubMed Score 111.80
PubTator Score 113.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.842 3.3e-07
Atopic dermatitis -1.100 2.5e-02
Breast cancer -1.100 1.3e-02
breast carcinoma 2.100 3.1e-05
ductal carcinoma in situ 1.300 3.3e-02
esophageal adenocarcinoma 1.800 1.8e-02
interstitial cystitis -2.500 3.9e-03
invasive ductal carcinoma 1.500 6.7e-03
lung adenocarcinoma -1.200 1.7e-07
lung cancer -1.100 1.2e-03
lung carcinoma -2.300 2.7e-20
nephrosclerosis -1.767 1.5e-02
non-small cell lung cancer -2.890 1.8e-16
osteosarcoma -1.298 5.0e-03
ovarian cancer -2.100 1.2e-09
pancreatic ductal adenocarcinoma liver m... -2.152 1.6e-02
psoriasis -1.700 6.5e-05
urothelial carcinoma -1.700 3.2e-02

Gene RIF (37)

AA Sequence

MADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQ      1 - 70
VKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIY     71 - 140
RKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIY    141 - 210
SLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLY    211 - 280
ECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQ                281 - 338
//

Text Mined References (76)

PMID Year Title