Property Summary

NCBI Gene PubMed Count 60
Grant Count 102
R01 Count 50
Funding $17,399,512.93
PubMed Score 107.92
PubTator Score 113.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
nephrosclerosis -1.767 0.015
urothelial carcinoma -1.700 0.032
esophageal adenocarcinoma 1.800 0.018
psoriasis -1.700 0.000
osteosarcoma -1.298 0.005
Atopic dermatitis -1.100 0.025
adrenocortical carcinoma -1.842 0.000
pancreatic ductal adenocarcinoma liver m... -2.152 0.016
non-small cell lung cancer -2.890 0.000
lung cancer -2.400 0.000
breast carcinoma 2.100 0.000
interstitial cystitis -3.600 0.000
lung adenocarcinoma -1.400 0.001
lung carcinoma -2.300 0.000
ductal carcinoma in situ 1.300 0.033
invasive ductal carcinoma 1.500 0.007
ovarian cancer -2.100 0.000
Breast cancer -1.100 0.013

Synonym

Accession P09467 O75571 Q53F94 Q96E46 FBPase 1
Symbols FBP

Gene

PDB

1FTA   2FHY   2FIE   2FIX   2JJK   2VT5   2WBB   2WBD   2Y5K   2Y5L   3A29   3KBZ   3KC0   3KC1   4MJO  

Gene RIF (28)

PMID Text
26546081 identified Zinc finger E-box-binding homeobox 1 (ZEB1) bond to FBP1 promoter to enhance DNA methylation in lung cancer cells. Our findings indicate that the down-regulation of FBP1 is a critical oncogenic event in lung cancer progression
26469968 FBP1 expression, which is closely correlated with c-Myc expression, is an independent prognostic factor and promotes nasopharyngeal carcinoma progression.
26068981 NPM1 promotes aerobic glycolysis and tumor progression in patients with pancreatic cancer by inhibiting FBP1
25844935 There was a negative correlation with the level of FBP1 and recurrence of the lung cancer
25601412 Twelve different mutations were identified in 22 alleles: one missense mutation c.472C > T, one point deletion c.48del, one point duplication c.865dupA, one deletion-insertion, and two splice mutations (c.427-1del and c.825 + 1G > A).
25043030 the gluconeogenic enzyme fructose-1,6-bisphosphatase 1 (FBP1) is uniformly depleted in over six hundred clear cell renal cell carcinoma tumours examined.
24146906 Ca(2+) affects conformation of the catalytic loop 52-72 of muscle FBPase and inhibits its activity by competing with activatory divalent cations, e.g. Mg(2+) and Zn(2+).
24007283 A homozygous c.658delT mutation was detected at exon 5 of the FBP1 gene in the two siblings with FBPase deficiency.
23881342 A novel missense mutation (c.841G>A) in the FBP1 gene seems to be prevalent in Pakistani-Indian patients with fructose-1,6-bisphosphatase deficiency.
23755305 LSD1 regulates transcription activation of two gluconeogenic genes, FBP1 and G6Pase.
More...

AA Sequence

MADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQ      1 - 70
VKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIY     71 - 140
RKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIY    141 - 210
SLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLY    211 - 280
ECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQ                281 - 338
//

Text Mined References (65)

PMID Year Title
26546081 2016 Down-regulation of FBP1 by ZEB1-mediated repression confers to growth and invasion in lung cancer cells.
26469968 2015 Far upstream element-binding protein 1 is a prognostic biomarker and promotes nasopharyngeal carcinoma progression.
26068981 2015 NPM1 activates metabolic changes by inhibiting FBP1 while promoting the tumorigenicity of pancreatic cancer cells.
25844935 2015 Down Expression of FBP1 Is a Negative Prognostic Factor for Non-Small-Cell Lung Cancer.
25601412 2015 Fructose 1,6-bisphosphatase deficiency: clinical, biochemical and genetic features in French patients.
25416956 2014 A proteome-scale map of the human interactome network.
25043030 2014 Fructose-1,6-bisphosphatase opposes renal carcinoma progression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24146906 2013 The mechanism of calcium-induced inhibition of muscle fructose 1,6-bisphosphatase and destabilization of glyconeogenic complex.
24007283 2013 Novel fructose-1,6-bisphosphatase gene mutation in two siblings.
More...