Property Summary

NCBI Gene PubMed Count 116
PubMed Score 716.87
PubTator Score 886.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.029 3.5e-03
psoriasis 1.700 2.2e-17

Synonym

Accession P09466 Q5T6T1 Q9UG92 GD
Symbols GD
GdA
GdF
GdS
PEP
PAEG
PP14
ZIF-1

Gene

PANTHER Protein Class (1)

PDB

4R0B  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (81)

AA Sequence

MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPED      1 - 70
NLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYL     71 - 140
ARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF                                  141 - 180
//

Text Mined References (119)

PMID Year Title