Property Summary

NCBI Gene PubMed Count 116
PubMed Score 716.87
PubTator Score 886.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.029 3.5e-03
psoriasis 1.700 2.2e-17

Gene RIF (81)

AA Sequence

MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPED      1 - 70
NLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYL     71 - 140
ARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF                                  141 - 180
//

Text Mined References (119)

PMID Year Title