Property Summary

NCBI Gene PubMed Count 113
PubMed Score 678.74
PubTator Score 886.11

Knowledge Summary


No data available


  Disease Sources (3)


  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.029 0.003
psoriasis 1.700 0.000


Accession P09466 Q5T6T1 Q9UG92 GD
Symbols GD


PANTHER Protein Class (1)



  Ortholog (2)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid

Gene RIF (79)

26757357 the role of glycodelin-A in placental development and fetomaternal tolerance in early pregnancy.
25901080 Altogether, the comprehensive characterization of glycodelin in non-small cell lung cancer provides strong support for its use as a biomarker with immune modulatory function.
25785839 The current study investigates the role of melanoma cell-secreted PAEP protein in regulating T cell function.
25747132 Both blood and tissue measurements of MUC-1 and GdA were significantly lower in women with recurrent implantation failure than in fertile women during the implantation window.
25422905 The dimeric crystal structure of the human fertility lipocalin glycodelin reveals a protein scaffold for the presentation of complex glycans.
24733737 Glycodelin-A treatment reduces the adverse effect of macrophage co-culture on human sperm motility.
24518545 Three months after myomectomy, endometrial glycodelin levels are significantly increased in infertile women with myoma.
24377825 Gd and GdA are commonly expressed in endometrial cancer tissue and seem to be of relevance in tumourigenesis.
24060634 Glycodelin-A binds to KLF11 and is differentially activated and repressed by KLF11 in ovarian endometrium.
23670949 Results suggest that PP-14 may play an important role in the pathogenesis of endometriosis.

AA Sequence

ARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF                                  141 - 180

Text Mined References (114)

PMID Year Title
26757357 2016 The Pleiotropic Effect of Glycodelin-A in Early Pregnancy.
25901080 2015 Glycodelin: A New Biomarker with Immunomodulatory Functions in Non-Small Cell Lung Cancer.
25785839 2015 Human malignant melanoma-derived progestagen-associated endometrial protein immunosuppresses T lymphocytes in vitro.
25747132 2015 Role of Mucin 1 and Glycodelin A in recurrent implantation failure.
25422905 2015 The dimeric crystal structure of the human fertility lipocalin glycodelin reveals a protein scaffold for the presentation of complex glycans.
25416956 2014 A proteome-scale map of the human interactome network.
24733737 2014 Glycodelin-A treatment reduces the adverse effect of macrophage co-culture on human sperm motility.
24518545 2014 Effect of myomectomy on endometrial glutathione peroxidase 3 (GPx3) and glycodelin mRNA expression at the time of the implantation window.
24377825 2013 Immunosuppressive Glycodelin A is an independent marker for poor prognosis in endometrial cancer.
24060634 2014 KLF11 epigenetically regulates glycodelin-A, a marker of endometrial biology via histone-modifying chromatin mechanisms.