Property Summary

NCBI Gene PubMed Count 54
Grant Count 140
R01 Count 119
Funding $12,796,249.58
PubMed Score 469.57
PubTator Score 173.90

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P09455 A8K2Q0 B7Z7A0 E7EWV0 F2Z2F2 Q6FGX8
Symbols CRBP
RBPC
CRBP1
CRBPI
CRABP-I

Gene

PDB

5H8T   5H9A   5HA1   5HBS  

Gene RIF (34)

PMID Text
26900151 This conformational flexibility of human apo-CRBP1 facilitates interaction with the ligands, whereas the more rigid holoprotein structure protects the labile retinoid moiety during vitamin A transport.
25879031 Further studies are needed to explore new therapeutic strategies aimed at restoring CRBP-1-mediated intracellular retinol trafficking and the meaning of CRBP-1 expression in cancer patients screening for a more personalized and efficacy retinoid therapy
25720522 Hypermethylation of CRBP1 gene is associated with Epstein-Barr virus-associated gastric carcinomas.
25143356 RBP1 expression was reduced in tissue and endometrial stromal cells derived from endometritis lesions versus eutopic endometruim in humans and mice.
24982334 CRBP-1 loss in G2/G3 ovarian carcinomas and increased apoptotic susceptibility to retinoids.
24269351 Factors involved in the retinoid pathway, in particular upregulation of CRBP, CRABP1 and CRABP2, also showed differential expression in tumors with different histological subtypes
24040446 Suggest CRBP1 gene as a tumor suppressor gene for cervical cancer.
23890161 Functional hepatic stellate cells coexpressing both LRAT and CRBP-1, that continue to maintain the ability to store vitamin A, contribute in part to the development of portal and parenchymal fibrogenesis in patients with viral hepatitis.
23414180 High urine retinol binding protein is associated with interstitial fibrosis and tubular atrophy plus inflammation.
22945948 RBP1 promoter hypermethylation is found in nearly all IDH1 and IDH2 mutant gliomas Because RBP1 is involved in retinoic acid synthesis, results suggest that dysregltion of RA metabolism may contribute to glioma formation along the IDH1/IDH2-mutant pathway
More...

AA Sequence

MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKE      1 - 70
FEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ          71 - 135
//

Text Mined References (60)

PMID Year Title
26900151 2016 Ligand Binding Induces Conformational Changes in Human Cellular Retinol-binding Protein 1 (CRBP1) Revealed by Atomic Resolution Crystal Structures.
25879031 2015 Vitamin A, cancer treatment and prevention: the new role of cellular retinol binding proteins.
25720522 2015 Aberrant gene promoter methylation of p16, FHIT, CRBP1, WWOX, and DLC-1 in Epstein-Barr virus-associated gastric carcinomas.
25143356 2014 Retinoic acid biosynthesis is impaired in human and murine endometriosis.
24982334 2014 CRBP-1 expression in ovarian cancer: a potential therapeutic target.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269351 2014 Proteome analysis of the effects of all-trans retinoic acid on human germ cell tumor cell lines.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24040446 2013 Cellular retinol binding protein 1 could be a tumor suppressor gene in cervical cancer.
More...