Property Summary

NCBI Gene PubMed Count 57
PubMed Score 476.21
PubTator Score 173.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -1.400 1.2e-02
astrocytic glioma -2.000 1.7e-02
Astrocytoma, Pilocytic 2.600 1.1e-08
atypical teratoid / rhabdoid tumor 1.300 2.7e-02
Breast cancer -1.200 8.1e-03
ductal carcinoma in situ 1.200 3.0e-02
ependymoma 2.300 1.6e-09
esophageal adenocarcinoma -1.200 3.3e-02
glioblastoma 2.400 4.2e-09
group 4 medulloblastoma 1.400 2.8e-03
intraductal papillary-mucinous adenoma (... -4.800 2.3e-06
intraductal papillary-mucinous carcinoma... -4.600 2.3e-05
intraductal papillary-mucinous neoplasm ... -4.900 2.2e-04
lung adenocarcinoma -1.200 6.4e-05
lung cancer 3.000 3.0e-05
osteosarcoma -1.714 4.6e-02
ovarian cancer -1.900 1.8e-04
pancreatic cancer -1.300 1.6e-03
pediatric high grade glioma 2.300 3.3e-06
pituitary cancer 1.400 5.0e-06
primary pancreatic ductal adenocarcinoma -1.718 8.6e-03
primitive neuroectodermal tumor 2.000 3.4e-02
psoriasis -1.400 2.2e-03

Synonym

Accession P09455 A8K2Q0 B7Z7A0 E7EWV0 F2Z2F2 Q6FGX8
Symbols CRBP
RBPC
CRBP1
CRBPI
CRABP-I

Gene

PDB

5H8T   5H9A   5HA1   5HBS   5LJB   5LJC   5LJD   5LJE   5LJG   5LJH   5LJK  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (35)

AA Sequence

MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKE      1 - 70
FEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ          71 - 135
//

Text Mined References (64)

PMID Year Title