Property Summary

NCBI Gene PubMed Count 23
PubMed Score 59.41
PubTator Score 150.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.6e-02

 GO Function (1)

Gene RIF (10)

AA Sequence

MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL                     1 - 55
//

Text Mined References (23)

PMID Year Title