Property Summary

NCBI Gene PubMed Count 23
Grant Count 2
R01 Count 2
Funding $264,574
PubMed Score 57.86
PubTator Score 150.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.026

Synonym

Accession P09430 STP-1
Symbols TP1

Gene

 Grant Application (2)

 GO Function (1)

Gene RIF (10)

PMID Text
26098692 Among Systemic lupus erythematosus patients, 63.6% and 45.5% of those with lupus nephritis were positive for anti-RRP8 and anti-TNP1 antibodies, compared with 12.5% and 9.4% of Systemic lupus erythematosus patients without nephritis, respectively.
20522125 frequency of the haplotype GCG (H3) was increased in azoospermic men compared with fertile men. expression analysis of the TNP1 gene in obstructive azoospermic men showed that haplotypes of the TNP1 gene do not affect its expression level.
20522125 Observational study of gene-disease association. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
18727729 The presence of transition proteins (TP1 and/or TP2) in spermatids in semen indicates inhibition in the differentiation pathway from round spermatids to spermatozoa in infertile men.
18292840 The TNP1 contributes not only to successful fertilization, but may has an important impact in development of preimplantation embryos.
17852044 We found significantly lower levels of HILS1, TNP1, and TNP2 transcripts in spermatozoa from asthenozoospermic men compared to normozoospermic men.
16989827 Observational study of gene-disease association. (HuGE Navigator)
16291974 Observational study of gene-disease association. (HuGE Navigator)
16291974 a deletion of 15 nucleotides encompassing the recognition site for the cAMP response element transcription factor was found in the 5'-promoter region of the TNP1 gene in infertile men; this deletion reduces TNP1 expression and may cause infertility

AA Sequence

MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL                     1 - 55
//

Text Mined References (23)

PMID Year Title
26098692 2015 Novel Autoantigens Associated with Lupus Nephritis.
25416956 2014 A proteome-scale map of the human interactome network.
21931568 2011 Genome-wide association study identifies four loci associated with eruption of permanent teeth.
20522125 2011 The TNP1 haplotype - GCG is associated with azoospermia.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
18727729 2008 Spermiogenesis defects in human: detection of transition proteins in semen from some infertile men.
18292840 2007 Association between fertilin beta, protamines 1 and 2 and spermatid-specific linker histone H1-like protein mRNA levels, fertilization ability of human spermatozoa, and quality of preimplantation embryos.
17852044 Quantitative assessment of transition proteins 1, 2 spermatid-specific linker histone H1-like protein transcripts in spermatozoa from normozoospermic and asthenozoospermic men.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16989827 2006 Identification of novel polymorphisms in the nuclear protein genes and their relationship with human sperm protamine deficiency and severe male infertility.
More...