Property Summary

NCBI Gene PubMed Count 787
PubMed Score 2190.43
PubTator Score 1525.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.100 3.2e-12
lung adenocarcinoma -1.500 3.2e-13
ovarian cancer -1.200 3.4e-03
primary pancreatic ductal adenocarcinoma 1.146 3.9e-02

Protein-protein Interaction (6)

Gene RIF (730)

AA Sequence

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR      1 - 70
YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD     71 - 140
KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE    141 - 210
DDDDE                                                                     211 - 215
//

Text Mined References (821)

PMID Year Title