Property Summary

NCBI Gene PubMed Count 655
PubMed Score 1948.79
PubTator Score 1525.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.146 0.039
lung adenocarcinoma -1.500 0.000
Breast cancer -1.100 0.000
ovarian cancer -1.200 0.003

Synonym

Accession P09429 A5D8W9 Q14321 Q5T7C3 Q6IBE1
Symbols HMG1
HMG3
HMG-1
SBP-1

Gene

PDB

2LY4   2RTU   2YRQ  

 GWAS Trait (1)

Gene RIF (598)

PMID Text
27333763 It plays a critical role as a proinflammatory mediator. HMGB1 represents an important new target for drug development in a variety of inflammatory disorders. (review)
27049097 HMGB1 interference can reduce VEGF and CXCL12 expression in ovarian cancer cells, but increase the apoptosis of ovarian cancer cells.
27026438 Multi-walled carbon nanotube induces injury or necrosis of lung epithelial cells and DNA damage via HMGB1/RAGE/TLR9 pathway.
26952810 Our data suggested that MIF affected the intrinsic properties of tumors and the host immune response in tumor microenvironment by regulating the TLR4/HMGB1 axis, leading to metastasis of breast cancer
26948869 HMGB1 inhibits the pyruvate kinase isoform M2, thus blocking glucose-driven aerobic respiration in cancer cells.
26872033 HMGB1 and TLR4 are overexpressed in endometriosis patients and correlate with the extent of stromal and epithelial cell death.
26871575 HMGB1 as a trigger for IFN-alpha-mediated TRAIL expression at the surface of Plasmacytoid dendritic cells (pDCs) and Natural Killer (NK) Cells, and they suggest a novel mechanism of innate control of HIV-1 infection.
26798412 HMGB-1 may play an important role in diabetes-induced oxidative stress.
26760176 HMGB1 was increased in Cystic fibrosis patients with deranging glucose metabolism and showed relationships with indexes of glucose metabolism.
26744383 HMGB1 could significantly enhance the migration of osteoblasts in vitro, and TLR2/TLR4-dependent NF-kappaB pathways are involved in HMGB1-induced osteoblast migration.
More...

AA Sequence

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR      1 - 70
YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD     71 - 140
KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE    141 - 210
DDDDE                                                                     211 - 215
//

Text Mined References (687)

PMID Year Title
27333763 2016 [Current status and future prospects in HMGB1 and receptor researches].
27049097 Changes of HMGB1 expression on angiogenesis of ovarian cancer and its mechanism.
27026438 2016 Multi-walled carbon nanotube induces nitrative DNA damage in human lung epithelial cells via HMGB1-RAGE interaction and Toll-like receptor 9 activation.
26952810 2016 Macrophage migration inhibitory factor promotes breast cancer metastasis via activation of HMGB1/TLR4/NF kappa B axis.
26948869 2016 The HMGB1 protein induces a metabolic type of tumour cell death by blocking aerobic respiration.
26872033 2016 Pathophysiology of Endometriosis: Role of High Mobility Group Box-1 and Toll-Like Receptor 4 Developing Inflammation in Endometrium.
26871575 2016 HMGB1 Is Involved in IFN-? Production and TRAIL Expression by HIV-1-Exposed Plasmacytoid Dendritic Cells: Impact of the Crosstalk with NK Cells.
26798412 2016 Diabetes-Induced Oxidative Stress in Endothelial Progenitor Cells May Be Sustained by a Positive Feedback Loop Involving High Mobility Group Box-1.
26760176 2016 HMGB1 Is Increased by CFTR Loss of Function, Is Lowered by Insulin, and Increases In Vivo at Onset of CFRD.
26744383 2016 rhHMGB1 drives osteoblast migration in a TLR2/TLR4- and NF-?B-dependent manner.
More...