Property Summary

Ligand Count 3
NCBI Gene PubMed Count 344
PubMed Score 744.64
PubTator Score 1537.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia 2.000 3.9e-02
Breast cancer 1.400 3.6e-04
cystic fibrosis 1.500 3.5e-04
diabetes mellitus -1.500 3.4e-03
ependymoma 1.200 9.3e-05
fibroadenoma -1.200 2.2e-02
gastric carcinoma 1.700 9.8e-03
glioblastoma 2.100 6.0e-03
group 4 medulloblastoma -1.800 6.3e-04
intraductal papillary-mucinous adenoma (... -2.300 2.7e-04
intraductal papillary-mucinous carcinoma... -2.300 1.2e-02
lung carcinoma -1.400 8.1e-22
medulloblastoma, large-cell -1.100 2.6e-03
nasopharyngeal carcinoma 1.900 7.3e-06
non primary Sjogren syndrome sicca 1.100 1.9e-02
osteosarcoma 1.885 6.9e-04
ovarian cancer -2.600 8.6e-07
pancreatic cancer 1.200 4.0e-03
pituitary cancer -1.100 2.6e-03
primary pancreatic ductal adenocarcinoma 2.603 3.5e-04
subependymal giant cell astrocytoma 2.120 1.5e-02
ulcerative colitis 1.400 5.4e-03
Waldenstrons macroglobulinemia 1.353 3.1e-03

Synonym

Accession P09382 B2R5E8 Q9UDK5 Gal-1
Symbols GBP
GAL1

Gene

PANTHER Protein Class (1)

PDB

1GZW   1W6M   1W6N   1W6O   1W6P   1W6Q   2KM2   2ZKN   3OY8   3OYW   3T2T   3W58   3W59   4Q1P   4Q1R   4Q26   4Q27   4Q2F   4XBL   4Y1U   4Y1V   4Y1X   4Y1Y   4Y1Z   4Y20   4Y22   4Y24  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (293)

AA Sequence

MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG      1 - 70
TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD          71 - 135
//

Text Mined References (356)

PMID Year Title