Property Summary

NCBI Gene PubMed Count 318
Grant Count 132
R01 Count 73
Funding $11,777,365.58
PubMed Score 728.54
PubTator Score 1537.16

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P09382 B2R5E8 Q9UDK5 Gal-1
Symbols GBP
GAL1

Gene

PANTHER Protein Class (1)

PDB

1GZW   1W6M   1W6N   1W6O   1W6P   1W6Q   2KM2   2ZKN   3OY8   3OYW   3T2T   3W58   3W59   4Q1P   4Q1R   4Q26   4Q27   4Q2F   4XBL   4Y1U   4Y1V   4Y1X   4Y1Y   4Y1Z   4Y20   4Y22   4Y24  

Gene RIF (271)

PMID Text
26891020 The integrative analysis of galectins(Gal-1, -3, -4, -9) discriminated IBD from other intestinal inflammatory conditions and could be used as potential mucosal biomarker
26885508 Galectin-1 was undetectable in normal and ulcerative colitis colonic epithelium, while galectin-2, galectin-3, and galectin-4 were strongly expressed.
26876172 Tumor-driven, unremitting expression of Satb1 in activated Zbtb46+ inflammatory dendritic cells that infiltrate ovarian tumors results in an immunosuppressive phenotype characterized by increased secretion of tumor-promoting Galectin-1 and IL-6.
26859293 Galectin-1-Induced Autophagy Facilitates Cisplatin Resistance of Hepatocellular Carcinoma
26792806 This study thus identifies Galectin-1 as a master regulator of clinically relevant inflammatory-response genes, working via NF-kappaB
26759008 Galectin-1 is associated with poor prognosis in patients with cutaneous head and neck cancer with perineural spread
26589797 galectin-1 and -3 are expressed by the human cervical and vaginal epithelial cells and act as pathogen-recognition receptors for the ceramide phosphoinositol glycan core (CPI-GC) of the dominant surface protozoan lipophosphoglycan.
26551914 Our results suggest that Gal1 and TGF-beta1 might function coordinately within the HCC microenvironment to regulate tumor growth, invasion, metastasis, and angiogenesis.
26448934 Galectin-1 could predict more lymph node metastasis in colorectal cancer patients with normal serum carcinoembryonic antigen.
26413750 LYAR may promote tumor cell migration and invasion by upregulating galectin-1 gene expression in colorectal cancer.
More...

AA Sequence

MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG      1 - 70
TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD          71 - 135
//

Text Mined References (330)

PMID Year Title
26891020 A galectin-specific signature in the gut delineates Crohn's disease and ulcerative colitis from other human inflammatory intestinal disorders.
26885508 2016 Immunohistochemical Studies on Galectin Expression in Colectomised Patients with Ulcerative Colitis.
26876172 2016 Satb1 Overexpression Drives Tumor-Promoting Activities in Cancer-Associated Dendritic Cells.
26859293 2016 Galectin-1-Induced Autophagy Facilitates Cisplatin Resistance of Hepatocellular Carcinoma.
26792806 2016 Galectin-1 Couples Glycobiology to Inflammation in Osteoarthritis through the Activation of an NF-?B-Regulated Gene Network.
26759008 2016 Galectin-1 is associated with poor prognosis in patients with cutaneous head and neck cancer with perineural spread.
26589797 2016 Trichomonas vaginalis Lipophosphoglycan Exploits Binding to Galectin-1 and -3 to Modulate Epithelial Immunity.
26551914 2016 Galectin-1 Controls the Proliferation and Migration of Liver Sinusoidal Endothelial Cells and Their Interaction With Hepatocarcinoma Cells.
26448934 2015 Circulating Galectin-1 and 90K/Mac-2BP Correlated with the Tumor Stages of Patients with Colorectal Cancer.
26413750 2015 LYAR promotes colorectal cancer cell mobility by activating galectin-1 expression.
More...