Property Summary

NCBI Gene PubMed Count 175
Grant Count 1,455
R01 Count 840
Funding $201,816,933.92
PubMed Score 1174.15
PubTator Score 419.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -6.100 0.000
Barrett's esophagus 2.000 0.021
esophageal adenocarcinoma 1.900 0.021
psoriasis 6.400 0.000
cutaneous lupus erythematosus 2.500 0.001
posterior fossa group A ependymoma 2.900 0.000
cystic fibrosis 3.879 0.001
periodontitis 1.800 0.000
Atopic dermatitis 1.600 0.019
tuberculosis -4.400 0.000
colon cancer 2.200 0.000
lung cancer -5.400 0.000
active Crohn's disease 5.044 0.007
ulcerative colitis 5.900 0.000
interstitial cystitis 3.300 0.000
invasive ductal carcinoma -2.208 0.006
nasopharyngeal carcinoma -1.700 0.006
inflammatory breast cancer -2.200 0.044
lung carcinoma -1.800 0.000
gastric carcinoma 1.900 0.036

Synonym

Accession P09341 Q9UCR7
Symbols FSP
GRO1
GROa
MGSA
NAP-3
SCYB1
MGSA-a

Gene

PDB

1MGS   1MSG   1MSH   1ROD  

Gene RIF (138)

PMID Text
27049944 work shows parallel networks of necroptosis-induced CXCL1 and Mincle signalling that promote macrophage-induced adaptive immune suppression and thereby enable pancreatic ductal adenocarcinoma progression
26721883 hCXCL1-GAG interactions provide stringent control over regulating chemokine levels and receptor accessibility and activation, and that chemotactic gradients mediate cellular trafficking to the target site.
26503598 CXCR2-CXCL1 axis is correlated with neutrophil infiltration and predicts a poor prognosis in hepatocellular carcinoma
26499374 these findings suggest that CXCL1 plays critical roles in the growth and apoptosis of hepatocellular carcinoma
26406865 Urine CXCL1 is a promising, non-invasive molecular marker for tumor detection and outcome prediction in patients with bladder cancer .
26397389 BBP also stimulated the production of CXCL1/GROalpha by TADCs, which increased the angiogenesis of breast cancer in a mouse model
26345899 Polymorphisms in the promoter regions of the CXCL1 and CXCL2 genes contribute to increased risk of alopecia areata in the Korean population
26341115 increased amounts released by neutrophils from fibromyalgia patients
26252654 TGF-beta negatively regulates CXCL1 expression in CAFs through Smad2/3 binding to the promoter, and through suppression of HGF/c-Met autocrine signaling
26104296 High CXCL1 expression is a poor prognostic biomarker in metastatic colorectal cancer.
More...

AA Sequence

MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCA      1 - 70
QTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN                                      71 - 107
//

Text Mined References (176)

PMID Year Title
27049944 2016 The necrosome promotes pancreatic oncogenesis via CXCL1 and Mincle-induced immune suppression.
26721883 2016 CXCL1/MGSA Is a Novel Glycosaminoglycan (GAG)-binding Chemokine: STRUCTURAL EVIDENCE FOR TWO DISTINCT NON-OVERLAPPING BINDING DOMAINS.
26503598 2015 CXCR2-CXCL1 axis is correlated with neutrophil infiltration and predicts a poor prognosis in hepatocellular carcinoma.
26499374 2015 Targeted silencing of CXCL1 by siRNA inhibits tumor growth and apoptosis in hepatocellular carcinoma.
26406865 2015 Urine CXCL1 as a biomarker for tumor detection and outcome prediction in bladder cancer.
26397389 2015 Benzyl butyl phthalate increases the chemoresistance to doxorubicin/cyclophosphamide by increasing breast cancer-associated dendritic cell-derived CXCL1/GRO? and S100A8/A9.
26345899 2015 Polymorphisms in the promoter regions of the CXCL1 and CXCL2 genes contribute to increased risk of alopecia areata in the Korean population.
26341115 2016 Altered release of chemokines by phagocytes from fibromyalgia patients: a pilot study.
26252654 2015 TGF-? Negatively Regulates CXCL1 Chemokine Expression in Mammary Fibroblasts through Enhancement of Smad2/3 and Suppression of HGF/c-Met Signaling Mechanisms.
26104296 2015 The prognostic significance of CXCL1 hypersecretion by human colorectal cancer epithelia and myofibroblasts.
More...