Property Summary

NCBI Gene PubMed Count 194
PubMed Score 1286.07
PubTator Score 419.96

Knowledge Summary


No data available


  Disease (4)


  Differential Expression (20)

Disease log2 FC p
psoriasis 2.200 3.0e-04
active Crohn's disease 5.044 7.1e-03
active ulcerative colitis 5.278 3.3e-03
Atopic dermatitis 1.600 1.9e-02
Barrett's esophagus 2.000 2.1e-02
colon cancer 1.300 2.7e-02
cutaneous lupus erythematosus 2.500 1.0e-03
cystic fibrosis 3.879 1.2e-03
ependymoma 1.500 4.5e-02
esophageal adenocarcinoma 1.900 2.1e-02
gastric carcinoma 1.900 3.6e-02
inflammatory breast cancer -2.200 4.4e-02
interstitial cystitis 1.800 7.2e-03
invasive ductal carcinoma -2.208 5.8e-03
lung cancer -3.400 5.8e-05
lung carcinoma -1.800 3.0e-08
malignant mesothelioma -6.100 8.3e-10
nasopharyngeal carcinoma -1.700 5.5e-03
periodontitis 1.800 1.2e-30
tuberculosis -4.400 4.3e-06


Accession P09341 Q9UCR7
Symbols FSP



1MGS   1MSG   1MSH   1ROD  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (4)

Gene RIF (160)

AA Sequence

QTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN                                      71 - 107

Text Mined References (195)

PMID Year Title