Property Summary

NCBI Gene PubMed Count 45
Grant Count 92
R01 Count 49
Funding $10,294,583.88
PubMed Score 153.65
PubTator Score 83.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P09327 B2R9A7 Q53S11 Q96AC8
Symbols VIL
D2S1471

Gene

PDB

1UNC   3FG7  

Gene RIF (20)

PMID Text
26658611 villin directly interacts with a transcriptional corepressor and ligand of the Slug promoter, ZBRK1.
26537799 Data indicate an association between highly fucosylated glycans and caudal type homeobox 1 (CDX1) and/or villin mRNA expression that both correlate with cell differentiation.
26334299 study demonstrates that G. duodenalis-mediated disruption of villin is, at least, in part dependent on activation of myosin light chain kinase
25600187 Thus, villin plays an important role in establishing the balance between actin polymerization and actin severing to facilitate the initial steps of Salmonella entry.
25517957 villin immunohistochemistry is a reliable and superior adjunct in the diagnosis of microvillus inclusion disease
25337239 Collective expression pattern of tensin/profilin-1/villin-1/talin could be a biomarker to estimate the prognosis of esophageal squamous cell carcinoma patients.
24266897 Discriminated small-cell lung carcinoma from large-cell neuroendocrine lung carcinoma with immunohistochemical markers BAI3, CDX2 and VIL1.
24250806 harmonin and villin autoantibodies are sensitive and specific markers of IPEX, differentiate IPEX, including atypical cases, from other early childhood disorders associated with enteropathy
22530999 We demonstrated that the VIL1 gene is a potential candidate molecular marker for high serum AFP-associated HCC and a predictive candidate for the postoperative recurrence and poorer prognosis of HCC.
21741320 identified villin, an actin-binding protein, as the 95 kDa antigen in four of five sera from patients with IPEX syndrome
More...

AA Sequence

MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDS      1 - 70
SLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLL     71 - 140
HVKGKRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGV    141 - 210
VDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLL    211 - 280
SHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWT    281 - 350
ASNRTSGLGKTHTVGSVAKVEQVKFDATSMHVKPQVAAQQKMVDDGSGEVQVWRIENLELVPVDSKWLGH    351 - 420
FYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVPMGKEPPHLMS    421 - 490
IFKGRMVVYQGGTSRTNNLETGPSTRLFQVQGTGANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCGK    491 - 560
GCSGDEREMAKMVADTISRTEKQVVVEGQEPANFWMALGGKAPYANTKRLQEENLVITPRLFECSNKTGR    561 - 630
FLATEIPDFNQDDLEEDDVFLLDVWDQVFFWIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQ    631 - 700
GHEPPTFTGWFLAWDPFKWSNTKSYEDLKAELGNSRDWSQITAEVTSPKVDVFNANSNLSSGPLPIFPLE    701 - 770
QLVNKPVEELPEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKEKGLF                 771 - 827
//

Text Mined References (56)

PMID Year Title
26658611 2016 By moonlighting in the nucleus, villin regulates epithelial plasticity.
26537799 2016 N-glycosylation Profiling of Colorectal Cancer Cell Lines Reveals Association of Fucosylation with Differentiation and Caudal Type Homebox 1 (CDX1)/Villin mRNA Expression.
26334299 2015 Giardia duodenalis Surface Cysteine Proteases Induce Cleavage of the Intestinal Epithelial Cytoskeletal Protein Villin via Myosin Light Chain Kinase.
25600187 2015 Apical invasion of intestinal epithelial cells by Salmonella typhimurium requires villin to remodel the brush border actin cytoskeleton.
25517957 2015 Villin immunohistochemistry is a reliable method for diagnosing microvillus inclusion disease.
25337239 2014 A four actin-binding protein signature model for poor prognosis of patients with esophageal squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24266897 2014 BAI3, CDX2 and VIL1: a panel of three antibodies to distinguish small cell from large cell neuroendocrine lung carcinomas.
24250806 2013 Autoantibodies to harmonin and villin are diagnostic markers in children with IPEX syndrome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...