Property Summary

NCBI Gene PubMed Count 47
PubMed Score 162.54
PubTator Score 83.94

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma 1.500 3.2e-02
intraductal papillary-mucinous adenoma (... -1.100 2.3e-02
intraductal papillary-mucinous carcinoma... 1.700 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.800 1.2e-02
lung carcinoma 1.400 3.8e-07
ovarian cancer -1.200 3.4e-05
pancreatic cancer 1.200 5.5e-04
pancreatic carcinoma 1.200 5.5e-04
psoriasis -1.300 1.6e-07
ulcerative colitis -1.400 3.0e-05

Gene RIF (22)

AA Sequence

MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDS      1 - 70
SLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLL     71 - 140
HVKGKRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGV    141 - 210
VDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLL    211 - 280
SHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWT    281 - 350
ASNRTSGLGKTHTVGSVAKVEQVKFDATSMHVKPQVAAQQKMVDDGSGEVQVWRIENLELVPVDSKWLGH    351 - 420
FYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVPMGKEPPHLMS    421 - 490
IFKGRMVVYQGGTSRTNNLETGPSTRLFQVQGTGANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCGK    491 - 560
GCSGDEREMAKMVADTISRTEKQVVVEGQEPANFWMALGGKAPYANTKRLQEENLVITPRLFECSNKTGR    561 - 630
FLATEIPDFNQDDLEEDDVFLLDVWDQVFFWIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQ    631 - 700
GHEPPTFTGWFLAWDPFKWSNTKSYEDLKAELGNSRDWSQITAEVTSPKVDVFNANSNLSSGPLPIFPLE    701 - 770
QLVNKPVEELPEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKEKGLF                 771 - 827
//

Text Mined References (58)

PMID Year Title