Property Summary

NCBI Gene PubMed Count 51
PubMed Score 359.48
PubTator Score 151.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 8.5495777460299E-18
non-small cell lung cancer 2798 1.24807948373054E-8
ovarian cancer 8492 9.9346573808814E-8
pilocytic astrocytoma 3086 4.2204248363307E-6
hepatocellular carcinoma 550 3.62287617240849E-5
primary Sjogren syndrome 789 4.95020429576093E-5
lung cancer 4473 6.73435830333449E-5
ulcerative colitis 2087 8.2125429610466E-5
cutaneous lupus erythematosus 1056 1.11988279045684E-4
pediatric high grade glioma 2712 4.24961989671212E-4
Multiple myeloma 1328 0.00117188281884889
psoriasis 6685 0.00140764152034406
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00317098484372371
glioblastoma 5572 0.00439587039890224
sarcoidosis 368 0.0129928591568987
osteosarcoma 7933 0.0134346458247866
subependymal giant cell astrocytoma 2287 0.0160211358743817
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0172863999318291
interstitial cystitis 2299 0.0194846995604981
invasive ductal carcinoma 2950 0.0203336294640846
Disease Target Count Z-score Confidence
Anemia 252 3.294 1.6
Proteinuria 63 3.058 1.5
Cancer 2346 3.028 1.5

Expression

  Differential Expression (20)

Synonym

Accession P09326 Q5U055 Q8MGR0
Symbols BCM1
BLAST
hCD48
mCD48
BLAST1
SLAMF2
MEM-102

Gene

PDB

2EDO  

  Ortholog (7)

 GO Function (1)

Gene RIF (27)

PMID Text
26926492 CD48 expression was increased in patients with a short disease duration compared to both controls and patients with longer disease duration. In patients with short disease duration, increased CD48 expression was associated with alveolar inflammation.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD48 (SLAMF2)
25255823 These data demonstrate the important role of CD48 in SA/exotoxins-eosinophil activating interactions that can take place during allergic responses and indicate CD48 as a novel therapeutic target for allergy and especially of AD.
24670806 we propose that SLAMF2 engagement regulates adaptive immune responses
24505299 Blockade of 2B4/CD48 interaction resulted in improvement in function via perforin expression and degranulation as measured by CD107a surface mobilization on HTLV-1 specific CD8+ T cells.
23225218 Monocyte-induced natural killer cell dysfunction was markedly attenuated by blocking CD48 receptor 2B4 on NK cells, but not by blockade of NKG2D and NKp30.
22495247 replication study of association of 2 SNPs in HERV-K18 and 19 tagSNPs in CD48 with schizophrenia (SZ)and type 2 diabetes (T2D) in patients with SZ in 2 Danish samples; no association was found with SZ or with T2D among individuals with SZ for any of the SNPs
20833258 Stimulation of CD48 induces rearrangement of signaling factors in lipid rafts, Lck-kinase activity, and tyrosine phosphorylation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWD      1 - 70
SRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEK     71 - 140
IEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVC    141 - 210
LSPPCTLARSFGVEWIASWLVVTVPTILGLLLT                                         211 - 243
//

Text Mined References (52)

PMID Year Title
26926492 2016 CD81 and CD48 show different expression on blood eosinophils in systemic sclerosis: new markers for disease and pulmonary inflammation?
25255823 2014 The CD48 receptor mediates Staphylococcus aureus human and murine eosinophil activation.
24670806 2014 Engagement of SLAMF2/CD48 prolongs the time frame of effective T cell activation by supporting mature dendritic cell survival.
24505299 2014 HTLV-1 specific CD8+ T cell function augmented by blockade of 2B4/CD48 interaction in HTLV-1 infection.
23225218 2013 Monocyte/macrophage-elicited natural killer cell dysfunction in hepatocellular carcinoma is mediated by CD48/2B4 interactions.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22495247 2012 No association of polymorphisms in human endogenous retrovirus K18 and CD48 with schizophrenia.
20833258 2011 CD48: A co-stimulatory receptor of immunity.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
More...