Property Summary

NCBI Gene PubMed Count 55
PubMed Score 369.23
PubTator Score 151.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.100 5.2e-03
Astrocytoma, Pilocytic 1.100 7.3e-06
cutaneous lupus erythematosus 3.400 1.1e-04
glioblastoma 1.700 4.4e-03
hepatocellular carcinoma 1.200 3.6e-05
interstitial cystitis 1.700 1.9e-02
intraductal papillary-mucinous carcinoma... -1.300 3.2e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.7e-02
invasive ductal carcinoma 1.243 2.0e-02
lung cancer -1.100 2.7e-02
lung carcinoma -1.700 8.5e-18
Multiple myeloma 2.123 1.2e-03
non-small cell lung cancer -1.189 1.2e-08
osteosarcoma -1.909 1.3e-02
ovarian cancer -1.100 2.4e-04
primary Sjogren syndrome 2.900 5.0e-05
psoriasis 1.300 1.4e-03
sarcoidosis 1.700 1.3e-02
subependymal giant cell astrocytoma 1.834 1.6e-02
ulcerative colitis 2.000 8.2e-05

Gene RIF (30)

AA Sequence

MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWD      1 - 70
SRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEK     71 - 140
IEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVC    141 - 210
LSPPCTLARSFGVEWIASWLVVTVPTILGLLLT                                         211 - 243
//

Text Mined References (56)

PMID Year Title