Property Summary

Ligand Count 80
NCBI Gene PubMed Count 97
PubMed Score 224.62
PubTator Score 210.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 1.7e-02
cutaneous lupus erythematosus 1.400 2.0e-02
cystic fibrosis 1.400 2.7e-02
ductal carcinoma in situ 2.600 3.9e-02
head and neck cancer and chronic obstruc... 2.600 1.9e-02
interstitial cystitis 4.300 2.9e-04
malignant mesothelioma 2.600 1.2e-07
non-small cell lung cancer 3.029 9.7e-08
psoriasis 1.100 2.4e-03
sarcoidosis 2.000 3.3e-02
ulcerative colitis 5.200 1.3e-08

Gene RIF (75)

AA Sequence

MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQFRRKDSNLIVKKIQGMQKFL      1 - 70
GLEVTGKLDTDTLEVMRKPRCGVPDVGHFSSFPGMPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVW     71 - 140
EEVTPLTFSRLYEGEADIMISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWTEDASGTN    141 - 210
LFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGPPPASTEEPLVPTKSVP    211 - 280
SGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWRRSHWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDT    281 - 350
VFIFKGNEFWAIRGNEVQAGYPRGIHTLGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSMEQG    351 - 420
FPRLIADDFPGVEPKVDAVLQAFGFFYFFSGSSQFEFDPNARMVTHILKSNSWLHC                  421 - 476
//

Text Mined References (99)

PMID Year Title