Property Summary

NCBI Gene PubMed Count 86
Grant Count 68
R01 Count 51
Funding $11,152,957.65
PubMed Score 213.83
PubTator Score 210.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession P09238 B2R9X9 Q53HH9 SL-2
Symbols SL-2
STMY2

Gene

PDB

3V96   1Q3A   4ILW  

Gene RIF (64)

PMID Text
26625808 According to this study, the expression of ST-2 is associated with histopathological grade and tumor differentiation in head and neck squamous cell carcinomas.
26415518 MMP-10 may be a novel biomarker reflecting both disease severity and prognosis in patients with idiopathic pulmonary fibrosis.
25808184 hepatocellular carcinoma cells stably expressing MMP10 had increased CXCR4 expression and migratory capacity
25742789 Up-regulation of matrix metalloproteinase 10 is associated with colitis-associated cancer.
25441671 Suggest that MMP-10 is associated with severity and poor outcome in peripheral arterial disease.
24885595 Taken together, our findings show that MMP-10 can play a significant role in tumor growth and progression, and that MMP-10 perturbation may represent a rational strategy for cancer treatment.
24884523 YY1 suppresses invasion and metastasis of pancreatic ductal adenocarcinoma by downregulating MMP10 in a MUC4/ErbB2/p38/MEF2C-dependent mechanism.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of matrix metallopeptidase 10 (MMP10; stromelysin 2) in primary human brain microvascular endothelial cells
24576976 Preliminary evidence suggests that MMP-10 may be a mediator of the number of depressive phases during bipolar disorder
24413984 Noncomplicated PVVs are associated with systemic, prothrombotic activation of hemostasis and increased concentration of MMP-10, suggesting a prothrombotic and proinflammatory state.
More...

AA Sequence

MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQFRRKDSNLIVKKIQGMQKFL      1 - 70
GLEVTGKLDTDTLEVMRKPRCGVPDVGHFSSFPGMPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVW     71 - 140
EEVTPLTFSRLYEGEADIMISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWTEDASGTN    141 - 210
LFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGPPPASTEEPLVPTKSVP    211 - 280
SGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWRRSHWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDT    281 - 350
VFIFKGNEFWAIRGNEVQAGYPRGIHTLGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSMEQG    351 - 420
FPRLIADDFPGVEPKVDAVLQAFGFFYFFSGSSQFEFDPNARMVTHILKSNSWLHC                  421 - 476
//

Text Mined References (88)

PMID Year Title
26625808 2015 Protein Expression of Stromelysin-2 in Head and Neck Squamous Cell Carcinomas.
26415518 2015 Matrix metalloproteinase-10: a novel biomarker for idiopathic pulmonary fibrosis.
25808184 2015 Matrix metalloproteinase 10 contributes to hepatocarcinogenesis in a novel crosstalk with the stromal derived factor 1/C-X-C chemokine receptor 4 axis.
25742789 2015 Up-regulation of matrix metalloproteinases in a mouse model of chemically induced colitis-associated cancer: the role of microRNAs.
25441671 2015 Matrix metalloproteinase 10 is associated with disease severity and mortality in patients with peripheral arterial disease.
24885595 2014 Matrix metalloproteinase-10 promotes tumor progression through regulation of angiogenic and apoptotic pathways in cervical tumors.
24884523 2014 Yin Yang-1 suppresses invasion and metastasis of pancreatic ductal adenocarcinoma by downregulating MMP10 in a MUC4/ErbB2/p38/MEF2C-dependent mechanism.
24576976 2014 Genetic variations within metalloproteinases impact on the prophylaxis of depressive phases in bipolar patients.
24413984 2015 Increased Levels of Metalloproteinase 10 and Hemostatic Markers in Patients With Noncomplicated Primary Varicose Veins.
24327153 2013 [Association between matrix metalloproteinase-10 gene polymorphisms and instability of carotid plaque].
More...