Property Summary

NCBI Gene PubMed Count 371
Grant Count 346
R01 Count 225
Funding $42,061,534.17
PubMed Score 960.59
PubTator Score 722.29

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P09237 Q9BTK9
Symbols MMP-7
MPSL1
PUMP-1

Gene

PDB

1MMP   1MMQ   1MMR   2DDY   2MZE   2MZH   2Y6C   2Y6D  

Gene RIF (348)

PMID Text
27078876 Data show that spider venom sphingomyelinase D increased expression/secretion of MMP2, MMP9 and MMP7 which was associated with keratinocyte cell death.
27069188 The multivariate stepwise logistic regression identified the following biomarkers as the best gastric cancer predictors: CEA, CA72-4, pepsinogen I, Helicobacter pylori presence and MMP7
26906940 Urinary MMP7 improves the overall diagnostic performance of urinary CXCL10 for distinguishing normal histology from subclinical and clinical inflammation/injury, but not subclinical inflammation alone.
26792722 Our data suggested a potential role of Rab11-FIP2 in tumor progression and provided novel insights into the mechanism of how Rab11-FIP2 positively regulated cell migration and invasion in CRC cells.
26652716 Expression of MMP2 and MMP7 in gastric cancer is not associated with mTOR, MMP9 expression might be related to mTOR signalling in a subset of tumors
26648518 These findings demonstrate that Tan-IIA inhibits the migration ability of AGS human gastric cancer cells and that decreasing the protein expression of NF-kappaB-p65, COX-2, and MMP-2, -7 and -9 may be an underlying molecular mechanism
26520416 MMP-7 expression is highly specific, though only of moderate sensitivity, for the diagnosis of carcinoma in the differential diagnosis from both benign and malignant mesothelial cells.
26507660 PKD2 is a core factor in the formation of this multiprotein complex at the TGN that controls constitutive secretion of matrix metalloproteinase cargo.
26464654 Protein, mRNA, and serum expression levels of MMP-7 and IL-15 in patients with osteoarthritis were all significantly increased in osteoarthritis patients compared with the control group.
26457789 Data suggest MMP7 (matrix metalloproteinase 7) in follicular fluid cleaves proNGF (pro-nerve growth factor) in ovarian follicle; both MMP7 and proNGF appear to be products of granulosa cells; processing of proNGF to NGF appears to regulate apoptosis.
More...

AA Sequence

MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPI      1 - 70
TGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEI     71 - 140
PLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLY    141 - 210
AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK                 211 - 267
//

Text Mined References (371)

PMID Year Title
27078876 2016 Sphingomyelinase D from Loxosceles laeta Venom Induces the Expression of MMP7 in Human Keratinocytes: Contribution to Dermonecrosis.
27069188 2016 Searching for New Biomarkers and the Use of Multivariate Analysis in Gastric Cancer Diagnostics.
26906940 2016 Elevated Urinary Matrix Metalloproteinase-7 Detects Underlying Renal Allograft Inflammation and Injury.
26792722 2016 Rab11-FIP2 promotes colorectal cancer migration and invasion by regulating PI3K/AKT/MMP7 signaling pathway.
26652716 2015 MMP2 and MMP7 at the invasive front of gastric cancer are not associated with mTOR expression.
26648518 2016 Tanshinone IIA decreases the migratory ability of AGS cells by decreasing the protein expression of matrix metalloproteinases, nuclear factor ?B-p65 and cyclooxygenase-2.
26520416 2016 MMP-7 is a highly specific negative marker for benign and malignant mesothelial cells in serous effusions.
26507660 2016 Protein Kinase D2 Assembles a Multiprotein Complex at the Trans-Golgi Network to Regulate Matrix Metalloproteinase Secretion.
26464654 2015 Expression and correlation of matrix metalloproteinase-7 and interleukin-15 in human osteoarthritis.
26457789 2015 Pro-nerve growth factor in the ovary and human granulosa cells.
More...