Property Summary

NCBI Gene PubMed Count 24
PubMed Score 32.04
PubTator Score 24.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 1.5e-04

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.300 1.5e-04

Gene RIF (4)

AA Sequence

MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAP      1 - 70
PPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMR     71 - 140
PPARPMMVPTRPGMTRPDR                                                       141 - 159
//

Text Mined References (34)

PMID Year Title