Property Summary

NCBI Gene PubMed Count 24
Grant Count 6
R01 Count 6
Funding $531,586.64
PubMed Score 30.93
PubTator Score 24.80

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.300 0.000

Gene RIF (4)

PMID Text
25625564 these studies establish potentially converging disease mechanisms in amyotrophic lateral sclerosis (ALS) and spinal muscular atrophy, with ALS-causative mutants acquiring properties representing both gain and loss of function.
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein polypeptide C (SNRPC), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
18854154 Knockdown of small nuclear ribonucleoprotein polypeptide C (SNRPC) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
12486009 binding of TIA-1 in the vicinity of a 5' ss helps to stabilize U1 snRNP recruitment, at least in part, via a direct interaction with U1-C

AA Sequence

MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAP      1 - 70
PPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMR     71 - 140
PPARPMMVPTRPGMTRPDR                                                       141 - 159
//

Text Mined References (34)

PMID Year Title
25625564 2015 ALS-causative mutations in FUS/TLS confer gain and loss of function by altered association with SMN and U1-snRNP.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...