Property Summary

NCBI Gene PubMed Count 38
PubMed Score 21.53
PubTator Score 43.96

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
ductal carcinoma in situ 1.200 4.4e-02
lung cancer 1.600 3.8e-04
lung carcinoma 1.100 1.8e-11
non-inflammatory breast cancer 1.200 1.7e-02
pancreatic cancer 1.700 9.8e-03
primary pancreatic ductal adenocarcinoma 1.523 1.6e-03
Rhinitis 1.500 1.2e-02
rhinitis with controlled asthma 1.900 7.2e-03

Gene RIF (8)

AA Sequence

MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV      1 - 70
LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFQIYEVPWEDRMSLVNSRCQE     71 - 140
A//

Text Mined References (40)

PMID Year Title