Property Summary

NCBI Gene PubMed Count 37
Grant Count 2
Funding $36,586.75
PubMed Score 20.62
PubTator Score 43.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (7)

PMID Text
23122533 This data suggests an autoimmune mechanism behind chronic mucocutaneous candidiasis in autoimmune polyendocrine syndrome type I and provides rationale for evaluating cystatin SA1 in antifungal therapy.
21846728 Identification of cystatin SA as a novel inhibitor of acid ceramidase.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
15829315 Murine monoclonal antibodies were made which can distinguish between CST1 and CST2.
12413693 cystatins SA1 and SA2 adhere to human fibroblasts and that the event results in tyrosine phosphorylation and upregulation of the release of IL-6 mediated enhancement of NF-kappa B activity.
12013824 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV      1 - 70
LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFQIYEVPWEDRMSLVNSRCQE     71 - 140
A//

Text Mined References (39)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25416956 2014 A proteome-scale map of the human interactome network.
24248522 2014 Salivary protein profiles are linked to bitter taste acceptance in infants.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23122533 2013 Autoimmunity and cystatin SA1 deficiency behind chronic mucocutaneous candidiasis in autoimmune polyendocrine syndrome type 1.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21846728 2011 Identification of cystatin SA as a novel inhibitor of acid ceramidase.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20189825 2010 Confident assignment of intact mass tags to human salivary cystatins using top-down Fourier-transform ion cyclotron resonance mass spectrometry.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
More...