Property Summary

NCBI Gene PubMed Count 1,361
Grant Count 374
R01 Count 202
Funding $34,566,390.14
PubMed Score 1707.51
PubTator Score 1659.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (57)

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.400 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.300 0.000
adrenocortical carcinoma -1.311 0.003
tuberculosis 1.200 0.000
pancreatic ductal adenocarcinoma liver m... 1.701 0.035
lung cancer 1.500 0.000
diabetes mellitus -1.100 0.003
sonic hedgehog group medulloblastoma 1.100 0.000
lung carcinoma -1.300 0.000
Breast cancer -1.100 0.009
ovarian cancer 1.500 0.000

Synonym

Accession P09211 O00460 Q15690 Q5TZY3
Symbols PI
DFN7
GST3
GSTP
FAEES3
HEL-S-22

Gene

PDB

10GS   11GS   12GS   13GS   14GS   16GS   17GS   18GS   19GS   1AQV   1AQW   1AQX   1EOG   1EOH   1GSS   1KBN   1LBK   1MD3   1MD4   1PGT   1PX6   1PX7   1ZGN   20GS   22GS   2A2R   2A2S   2GSS   2J9H   2PGT   3CSH   3CSI   3CSJ   3DD3   3DGQ   3GSS   3GUS   3HJM   3HJO   3HKR   3IE3   3KM6   3KMN   3KMO   3N9J   3PGT   4GSS   4PGT   5GSS   6GSS   7GSS   8GSS   9GSS  

Gene RIF (1522)

PMID Text
27468582 GSTP1 represents a new molecular biomarker which can aid in early detection of PCa and be used to discriminate between benign and malignant prostatic lesions from body fluids by noninvasive methods.
27002825 The study showed that polymorphims of the GSTM1 and GSTP1 could impact remission and adverse drug reactions in lupus nephritis treated with cyclophosphamide
26994385 Incidence of (Val/Val) genotype in colorectal cancer cases was three folds higher than controls.
26942188 cells was consistent with previous studies showing a constitutive expression of their GSTP1. Thus, while both ginger phenylpropanoids and quercetin have the property of increasing the level of Nrf2 both in HaCaT and in BJ cells, their effects on its downstream signalling were mediated only in BJ cells.
26823821 the GSTP1 Ile105Val and XRCC1 Arg194Trp were associated with better response to chemotherapy and longer survival of advanced non-small cell lung cancer
26725685 GSTP1 hypermethylation was associated with DNMT1, DNMT3a overexpression and oxidative stress in patients with HBeAg-positive chronic hepatitis b.
26722539 GSTP1 polymorphism was correlated with better response to chemotherapy and lower risk of death in advanced non-small cell lung cancer patients.
26681014 GG genotype of GSTP1 IIe105Val was significantly associated with better response to chemotherapy and breast cancer prognosis.
26663067 Data suggest that the combined genotypes of glutathionine S-transferase GSTM1 (-/-), GSTT1 (+/+), GSTP1 (AA) and meiotic recombination protein SPO11 (CT) may be associated with idiopathic male infertility in ethnic Han Chinese.
26612412 A three-way interaction among maternal and fetal variants in BHMT2, GSTP1 and GPX3 contribute to congenital heart defects
More...

AA Sequence

MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTIL      1 - 70
RHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGG     71 - 140
KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ    141 - 210
//

Text Mined References (1373)

PMID Year Title
27468582 2016 Molecular Diagnostic of Prostate Cancer From Body Fluids Using Methylation-Specific PCR (MS-PCR) Method.
27002825 2016 Glutathione S Transferases Polymorphisms Are Independent Prognostic Factors in Lupus Nephritis Treated with Cyclophosphamide.
26994385 2016 Does Val/Val genotype of GSTP1 enzyme affects susceptibility to colorectal cancer in Saudi Arabia?.
26942188 2016 Effects of Ginger Phenylpropanoids and Quercetin on Nrf2-ARE Pathway in Human BJ Fibroblasts and HaCaT Keratinocytes.
26823821 2015 Role of GSTP1 Ile105Val and XRCC1 Arg194Trp, Arg280His and Arg399Gln gene polymorphisms in the clinical outcome of advanced non-small cell lung cancer.
26725685 2016 Methylation of the Glutathione-S-Transferase P1 Gene Promoter Is Associated with Oxidative Stress in Patients with Chronic Hepatitis B.
26722539 2015 Association of GSTs gene polymorphisms with treatment outcome of advanced non-small cell lung cancer patients with cisplatin-based chemotherapy.
26681014 2015 Predictive potential role of glutathione S-transferases polymorphisms in response to chemotherapy and breast cancer prognosis.
26663067 2015 [Association of SPO11 and GST gene polymorphisms with idiopathic male infertility in ethnic Han Chinese].
26612412 2016 A Three-Way Interaction among Maternal and Fetal Variants Contributing to Congenital Heart Defects.
More...