Property Summary

NCBI Gene PubMed Count 56
Grant Count 20
R01 Count 20
Funding $752,976.42
PubMed Score 68.49
PubTator Score 77.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non-inflammatory breast cancer -1.200 0.030
lung carcinoma -1.200 0.018
psoriasis -1.700 0.002

Gene RIF (33)

PMID Text
24056816 the GSTA2 S112T polymorphism is predictive of transplant outcome in patients receiving busulfan in the preparative regimen, at least in association with cyclophosphamide.
23650189 Data indicate that steroidogenic factor 1 (SF-1) and glutathione S-transferase A (GSTA) family genes (hGSTA1-hGSTA4) are involved in steroidogenesis.
21844655 By direct resequencing of the 5'-flanking region, all the exons, and their flanking introns for 107 patients, 29 and 27 variants were identified in GSTA1 and GSTA2, respectively.
21792076 Single nucleotide polymorphism in GSTA2 is associated with low-stage non-small cell lung cancer.
21163259 Even with typical substrates, the astonishing concentration of glutathione transferase present in hepatocytes, causes an unusual "inverted" kinetics whereby the classical trends of v versus E and v versus S are reversed
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20437850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20434437 studied the five known allelic variants of human glutathione transferase A2-2 (GST A2-2) (EC 2.5.1.18), abundantly expressed in liver and efficiently catalyzing the bioactivation of azathioprine to release 6-mercaptopurine
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRA      1 - 70
ILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVL     71 - 140
KSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDE    141 - 210
KSLEESRKIFRF                                                              211 - 222
//

Text Mined References (57)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24056816 2014 Glutathione transferase-A2 S112T polymorphism predicts survival, transplant-related mortality, busulfan and bilirubin blood levels after allogeneic stem cell transplantation.
23650189 2013 Human glutathione S-transferase A (GSTA) family genes are regulated by steroidogenic factor 1 (SF-1) and are involved in steroidogenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21844655 2011 Genetic variation and haplotype structures of the glutathione S-transferase genes GSTA1 and GSTA2 in Japanese colorectal cancer patients.
21792076 2011 Systematic evaluation of genetic variants in three biological pathways on patient survival in low-stage non-small cell lung cancer.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21163259 2011 The extended catalysis of glutathione transferase.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...