Property Summary

NCBI Gene PubMed Count 185
Grant Count 279
R01 Count 149
Funding $53,883,968.42
PubMed Score 657.18
PubTator Score 1559.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical adenoma -1.038 0.018
adrenocortical carcinoma -1.117 0.000
aldosterone-producing adenoma -2.113 0.014

Synonym

Accession P09172 Q5T381 Q96AG2
Symbols DBM

Gene

DBH

PDB

4ZEL  

Gene RIF (193)

PMID Text
27239844 The frequencies of the rare alleles of CCR2, ITGB3, and 3'UTR of c-fms in the Old Believers are lower than in the sample of Novosibirsk Russians, and the rare allele of DBH is more frequent
26986136 did not find a significant association of rs1611115 with PTSD risk [meta-analysis]
26891013 No significant association was found between the DbetaH 5'-Ins/Del polymorphism and patients with chronic schizophrenia.
26762739 The p.Val26Met variant in the dopamine beta-hydroxylase gene at 9q34.2 was associated with Lung Cancer.
26632697 There was no significant relationship between Migraine susceptibility and genetic polymorphisms of DBH.
26400296 Reported is the construction of a tissue engineered intervertebral disc with high biological activity using an allogeneic intervertebral disc supplemented with transfected nucleus pulposus cells expressing exogenous dopamine beta-hydroxylase.
26356164 this study shows the influence of 444 G/A (rs 1108580) and -1021 C/T (rs 1611115) polymorphisms of the dopamine beta-hydroxylase (DBH) gene on clinical parameters of the trajectory of alcohol dependence.
25975715 A DBH gene variant, rs129882, which confers risk to attention deficit hyperactivity disorder, is also associated with reduced in vitro gene expression.
25450229 This study finding significant excess of rare nonsynonymous variants exclusive to European Americans smokers in DBH.
25336319 Results suggest that the DBH5'-Ins/Del polymorphism may not contribute directly to the development of tardive dyskinesia in schizophrenia, but it may be involved in the excited behavior of tardive dyskinesia patients
More...

AA Sequence

MPALSRWASLPGPSMREAAFMYSTAVAIFLVILVAALQGSAPRESPLPYHIPLDPEGSLELSWNVSYTQE      1 - 70
AIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQKGQIHLDPQQDYQLLQVQRTP     71 - 140
EGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSD    141 - 210
ACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGNEALVHHMEVFQCAPEMDSVPHFS    211 - 280
GPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIR    281 - 350
LYYTAKLRRFNAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV    351 - 420
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGGFGILEEMCVN    421 - 490
YVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAP    491 - 560
ISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQGRSPAGPTVVSIGGGKG                 561 - 617
//

Text Mined References (186)

PMID Year Title
27239844 [Gene Polymorphism of the c-fms, ITGB3,CCR2, and DBH genes in the populations of old believers of the Tyumen oblast and Russian residents of Novosibirsk].
27152332 2016 The crystal structure of human dopamine ?-hydroxylase at 2.9 Å resolution.
27148966 2016 Human Bacterial Artificial Chromosome (BAC) Transgenesis Fully Rescues Noradrenergic Function in Dopamine ?-Hydroxylase Knockout Mice.
26986136 2016 The Association Between Genetic Variants in the Dopaminergic System and Posttraumatic Stress Disorder: A Meta-Analysis.
26891013 2016 Association between D?H 5'-insertion/deletion polymorphism and cognition in patients with chronic schizophrenia.
26762739 2016 Focused Analysis of Exome Sequencing Data for Rare Germline Mutations in Familial and Sporadic Lung Cancer.
26632697 2015 Association Between Polymorphisms of DRD2, COMT, DBH, and MAO-A Genes and Migraine Susceptibility: A Meta-Analysis.
26400296 2015 Construction of a tissue engineered intervertebral disc with high biological activity using an allogeneic intervertebral disc supplemented with transfected nucleus pulposus cells expressing exogenous dopamine beta-hydroxylase.
26356164 2015 [The 444G/A and -1021 C/T polymorphisms of the dopamine-beta-hydroxylase gene modulate the trajectory of alcohol dependence development].
25975715 2015 Identification and functional characterisation of a novel dopamine beta hydroxylase gene variant associated with attention deficit hyperactivity disorder.
More...