Property Summary

NCBI Gene PubMed Count 21
PubMed Score 0.78
PubTator Score 40.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
20179341 crystal structures of a crenarchaeal and the all-human SRP19-signal recognition particle RNA binary complexes presented here show that the asymmetric loop is bulged out in both binary complexes.
17881443 Overexpression of SRP19 reduces the HIV-1 NC-mediated packaging of 7SL RNA and A3G into virions in a dose-dependent manner
17434535 Data show that the presence of SRP54 during SRP19-RNA assembly dramatically alters the folding energy landscape to create a non-native folding pathway that leads to an aberrant SRP19-RNA conformation.
12244299 crystal structure of a human SRP ternary complex consisting of SRP19, the M domain of SRP54 and the S domain of 7SL RNA
12050674 Structure of the SRP19 RNA complex
11641499 1.8 angstrom resolution crystal structure of human SRP19 in complex with its primary binding site on helix 6 of SRP RNA was determined

AA Sequence

MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSR      1 - 70
EWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKG     71 - 140
KKKK                                                                      141 - 144
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20179341 2010 Structural insights into the assembly of the human and archaeal signal recognition particles.
18089836 2008 A new mechanism of 6-((2-(dimethylamino)ethyl)amino)-3-hydroxy-7H-indeno(2,1-c)quinolin-7-one dihydrochloride (TAS-103) action discovered by target screening with drug-immobilized affinity beads.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17434535 2007 A threefold RNA-protein interface in the signal recognition particle gates native complex assembly.
16461635 2006 Decoding the fine-scale structure of a breast cancer genome and transcriptome.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12244299 2002 Induced structural changes of 7SL RNA during the assembly of human signal recognition particle.
11682607 2001 Signal recognition particle protein 19 is imported into the nucleus by importin 8 (RanBP8) and transportin.
11641499 2001 Crystal structure of an early protein-RNA assembly complex of the signal recognition particle.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10618370 2000 Signal recognition particle components in the nucleolus.
9016569 1997 Binding site of the M-domain of human protein SRP54 determined by systematic site-directed mutagenesis of signal recognition particle RNA.
2460823 1988 Isolation and characterization of a cDNA clone encoding the 19 kDa protein of signal recognition particle (SRP): expression and binding to 7SL RNA.
1678319 1991 Identification of deletion mutations and three new genes at the familial polyposis locus.
1651174 1991 Identification and characterization of the familial adenomatous polyposis coli gene.