Property Summary

NCBI Gene PubMed Count 21
Grant Count 4
R01 Count 4
Funding $253,129.25
PubMed Score 0.78
PubTator Score 40.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
20179341 crystal structures of a crenarchaeal and the all-human SRP19-signal recognition particle RNA binary complexes presented here show that the asymmetric loop is bulged out in both binary complexes.
17881443 Overexpression of SRP19 reduces the HIV-1 NC-mediated packaging of 7SL RNA and A3G into virions in a dose-dependent manner
17434535 Data show that the presence of SRP54 during SRP19-RNA assembly dramatically alters the folding energy landscape to create a non-native folding pathway that leads to an aberrant SRP19-RNA conformation.
12244299 crystal structure of a human SRP ternary complex consisting of SRP19, the M domain of SRP54 and the S domain of 7SL RNA
12050674 Structure of the SRP19 RNA complex
11641499 1.8 angstrom resolution crystal structure of human SRP19 in complex with its primary binding site on helix 6 of SRP RNA was determined

AA Sequence

MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSR      1 - 70
EWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKG     71 - 140
KKKK                                                                      141 - 144
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20179341 2010 Structural insights into the assembly of the human and archaeal signal recognition particles.
18089836 2008 A new mechanism of 6-((2-(dimethylamino)ethyl)amino)-3-hydroxy-7H-indeno(2,1-c)quinolin-7-one dihydrochloride (TAS-103) action discovered by target screening with drug-immobilized affinity beads.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17434535 2007 A threefold RNA-protein interface in the signal recognition particle gates native complex assembly.
16461635 2006 Decoding the fine-scale structure of a breast cancer genome and transcriptome.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...