Property Summary

NCBI Gene PubMed Count 34
Grant Count 6
R01 Count 5
Funding $282,690.83
PubMed Score 195.20
PubTator Score 75.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.017 0.001
malignant mesothelioma -1.400 0.000
psoriasis 2.100 0.000
osteosarcoma -1.139 0.001
astrocytoma 1.200 0.000
group 4 medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.500 0.000
pancreatic ductal adenocarcinoma liver m... -1.482 0.005
ulcerative colitis -1.200 0.000
ovarian cancer 1.900 0.000

Synonym

Accession P09110 G5E935 Q96CA6
Symbols ACAA
THIO
PTHIO

Gene

PANTHER Protein Class (2)

PDB

2IIK  

Gene RIF (10)

PMID Text
22151743 Findings suggest that protective effects of endotoxin exposure on asthma may vary depending upon the presence or absence of a polymorphism in ACAA1.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
16385653 Observational study of gene-disease association. (HuGE Navigator)
14621081 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT      1 - 70
AVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNG     71 - 140
SYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKA    141 - 210
ARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSD    211 - 280
GAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFAS    281 - 350
QAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE    351 - 420
YPGN                                                                      421 - 424
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22151743 2011 Effects of endotoxin exposure on childhood asthma risk are modified by a genetic polymorphism in ACAA1.
21269460 2011 Initial characterization of the human central proteome.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
19946888 2010 Defining the membrane proteome of NK cells.
More...