Property Summary

NCBI Gene PubMed Count 34
PubMed Score 203.78
PubTator Score 75.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.200 4.2e-04
group 4 medulloblastoma -1.600 4.1e-05
malignant mesothelioma -1.100 1.4e-05
medulloblastoma, large-cell -1.500 5.4e-07
Multiple myeloma 1.017 1.0e-03
osteosarcoma -1.139 1.2e-03
ovarian cancer -1.100 1.6e-04
pancreatic ductal adenocarcinoma liver m... -1.482 5.1e-03
psoriasis 2.100 6.9e-05
ulcerative colitis -1.200 1.1e-06

Protein-protein Interaction (3)

Gene RIF (10)

AA Sequence

MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT      1 - 70
AVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNG     71 - 140
SYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKA    141 - 210
ARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSD    211 - 280
GAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFAS    281 - 350
QAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE    351 - 420
YPGN                                                                      421 - 424
//

Text Mined References (39)

PMID Year Title