Property Summary

NCBI Gene PubMed Count 13
PubMed Score 99.83
PubTator Score 12.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 1.8e-10
glioblastoma 5792 1.4e-05
group 4 medulloblastoma 1855 8.1e-04
adult high grade glioma 3801 1.3e-03
oligodendroglioma 2850 2.4e-03
osteosarcoma 7950 3.6e-03
Disease Target Count Z-score Confidence
Thalassemia 53 6.072 3.0
Anemia 365 4.458 2.2

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 1.3e-03
ependymoma -1.200 1.8e-10
glioblastoma -1.400 1.4e-05
group 4 medulloblastoma -1.100 8.1e-04
oligodendroglioma -1.100 2.4e-03
osteosarcoma -2.494 3.6e-03

Synonym

Accession P09105 Q13723 Q1W6G5
Symbols HBQ

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

Gene RIF (1)

AA Sequence

MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLA      1 - 70
VERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSE     71 - 140
YR                                                                        141 - 142
//

Text Mined References (14)

PMID Year Title