Property Summary

NCBI Gene PubMed Count 126
Grant Count 189
R01 Count 124
Funding $43,314,570.85
PubMed Score 4373.72
PubTator Score 2505.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession P09104 B7Z2X9 Q96J33
Symbols NSE
HEL-S-279

Gene

PANTHER Protein Class (1)

PDB

1TE6   2AKM   2AKZ   3UCC   3UCD   3UJE   3UJF   3UJR   3UJS   4ZA0   4ZCW  

Gene RIF (104)

PMID Text
26730601 Data show that serum neuron-specific enolase, cytokeratin 19 fragment 21-1, pro-gastrin-releasing peptide, squamous cell carcinoma antigen, tissue inhibitor of metalloproteinase-1, and human epididymis protein 4 are not associated with brain metastases.
26481852 Elevation of neuron specific enolase and brain iron deposition is associated with beta-propeller protein-associated neurodegeneration.
26421286 This study inquires into the physiological concentrations of NSE and S100B proteins in CSF, carried out on a sufficiently large group of 601 patients.
26324761 NSE values is the best predictors of poor 6-month outcome after out-of-hospital cardiac arrest
26299616 Neuron specific enolase levels were not effective in predicting outcomes or detecting recurrences of Merkel cell carcinoma.
26040109 results suggested the use of serum S-100beta and NSE levels as indicators for brain injury
25918939 tRK1 forms a complex with human enolases and interacts with tRK1 and human pre-lysyl-tRNA synthetase (preKARS2)
25904356 In this study, the appearance of NeuN-positive cells were observed in the basal plate as early as 5 month of gestation.
25686504 The use of serum NSE as a diagnostic marker for disability progression in multiple sclerosis was not supported.
25518864 The association was studied of intracranial pressure (ICP) and cerebral perfusion pressure (CPP) on S-100B and neuron-specific enolase (NSE) in severe traumatic brain injury (sTBI).
More...

AA Sequence

MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN      1 - 70
STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN     71 - 140
SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE    141 - 210
GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY    211 - 280
QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV    281 - 350
TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE    351 - 420
ARFAGHNFRNPSVL                                                            421 - 434
//

Text Mined References (131)

PMID Year Title
26730601 2016 Serum Biomarkers Associated with Clinical Outcomes Fail to Predict Brain Metastases in Patients with Stage IV Non-Small Cell Lung Cancers.
26481852 2016 Elevation of neuron specific enolase and brain iron deposition on susceptibility-weighted imaging as diagnostic clues for beta-propeller protein-associated neurodegeneration in early childhood: Additional case report and review of the literature.
26421286 2015 Biomarkers of Brain Damage: S100B and NSE Concentrations in Cerebrospinal Fluid--A Normative Study.
26324761 2015 Neuron specific enolase and Glasgow motor score remain useful tools for assessing neurological prognosis after out-of-hospital cardiac arrest treated with therapeutic hypothermia.
26299616 2015 Evaluating blood levels of neuron specific enolase, chromogranin A, and circulating tumor cells as Merkel cell carcinoma biomarkers.
26040109 2015 Serum neuron-specific enolase and S-100? levels as prognostic follow-up markers for oxygen administered carbon monoxide intoxication cases.
25918939 2015 A Moonlighting Human Protein Is Involved in Mitochondrial Import of tRNA.
25904356 2015 Expression pattern of NeuN and GFAP during human fetal spinal cord development.
25686504 2015 Serum NSE level and disability progression in multiple sclerosis.
25518864 2015 Association of ICP, CPP, CT findings and S-100B and NSE in severe traumatic head injury. Prognostic value of the biomarkers.
More...