Property Summary

NCBI Gene PubMed Count 6
Grant Count 3
R01 Count 3
Funding $213,628.8
PubMed Score 18.08
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
12373299 expression of PE IIIA and its splicing variants in pancreatic carcinoma cells

AA Sequence

MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVT      1 - 70
AGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQ     71 - 140
LASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIR    141 - 210
SGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH              211 - 270
//

Text Mined References (7)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12373299 2002 Pancreatic elastase IIIA and its variants are expressed in pancreatic carcinoma cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2826474 1988 Identification of a novel class of elastase isozyme, human pancreatic elastase III, by cDNA and genomic gene cloning.
2460440 1988 Molecular cloning of complementary DNA encoding one of the human pancreatic protease E isozymes.