Property Summary

NCBI Gene PubMed Count 8
PubMed Score 18.62
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVT      1 - 70
AGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQ     71 - 140
LASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIR    141 - 210
SGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH              211 - 270
//

Text Mined References (9)

PMID Year Title