Property Summary

NCBI Gene PubMed Count 47
Grant Count 1
R01 Count 1
Funding $78,778.17
PubMed Score 28.66
PubTator Score 389.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -3.200 0.000
cystic fibrosis 1.179 0.002
primitive neuroectodermal tumor 1.700 0.030
interstitial cystitis 1.900 0.005
primary Sjogren syndrome 1.300 0.006
ulcerative colitis 1.100 0.009

Synonym

Accession P09086 Q16648 Q7M4M8 Q9BRS4
Symbols OCT2
OTF2
Oct-2

Gene

 Grant Application (1)

PDB

1HDP  

Gene RIF (21)

PMID Text
24435047 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24367622 a differential control exerted by both Oct-1 and Oct-2 in the transcriptional regulation of the HMGA1 gene
22346751 B-cell specific transcription factor, Oct-2, inhibits the function of the viral immediate-early protein, BZLF1, and prevents lytic viral reactivation. Oct-2 potentiates establishment of EBV latency in B cells.
22158496 Half of the cases displayed Oct-2 expression (15/30 cases) of systemic anaplastic large-cell lymphoma measured by tissue microarray immunohistochemistry.
21424034 Twenty-two cases of nodular lymphocyte predominant Hodgkin lymphoma were studied for the immunohistochemical expression of Pax-5, Oct-2, BOB.1, Bcl-6 protein and MUM1/IRF-4.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20363215 Gefitinib may exert an inhibitory effect on the intracellular accumulation of drugs transported by hOCT1 and hOCT2.
20141429 OCT-2 may act as a cell survival factor in acute myeloid leukemia by mediating expression of downstream targets, such as BCL-2.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19625999 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSG      1 - 70
DSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHLQPPAQFLLPQAQQSQPGLLP     71 - 140
TPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLSHPQPPKCLEPPSHPEEPSDLEELEQFARTF    141 - 210
KQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSP    211 - 280
NQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQ    281 - 350
KEKRINPCSAAPMLPSPGKPASYSPHMVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGG    351 - 420
GGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP               421 - 479
//

Text Mined References (49)

PMID Year Title
24435047 2014 Mutations in linker histone genes HIST1H1 B, C, D, and E; OCT2 (POU2F2); IRF8; and ARID1A underlying the pathogenesis of follicular lymphoma.
24367622 2013 Transcriptional regulation of the HMGA1 gene by octamer-binding proteins Oct-1 and Oct-2.
22346751 2012 The B-cell specific transcription factor, Oct-2, promotes Epstein-Barr virus latency by inhibiting the viral immediate-early protein, BZLF1.
22158496 Immunohistochemical expression of Mum-1, Oct-2 and Bcl-6 in systemic anaplastic large cell lymphomas.
21424034 2011 B-cell transcription factors Pax-5, Oct-2, BOB.1, Bcl-6, and MUM1 are useful markers for the diagnosis of nodular lymphocyte predominant Hodgkin lymphoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20363215 2010 Functional characterization of gefitinib uptake in non-small cell lung cancer cell lines.
20141429 2010 OCT-2 expression and OCT-2/BOB.1 co-expression predict prognosis in patients with newly diagnosed acute myeloid leukemia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19625999 2009 Contribution of organic cation transporter 2 (OCT2) to cisplatin-induced nephrotoxicity.
More...