Property Summary

NCBI Gene PubMed Count 49
PubMed Score 29.92
PubTator Score 389.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Lymphoma 81 3.103 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis 1.179 2.1e-03
interstitial cystitis 1.900 4.6e-03
osteosarcoma -2.372 9.8e-05
primary Sjogren syndrome 1.300 5.7e-03
primitive neuroectodermal tumor 1.700 3.0e-02
ulcerative colitis 1.100 9.5e-03

Protein-protein Interaction (2)

Gene RIF (23)

AA Sequence

MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSG      1 - 70
DSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHLQPPAQFLLPQAQQSQPGLLP     71 - 140
TPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLSHPQPPKCLEPPSHPEEPSDLEELEQFARTF    141 - 210
KQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSP    211 - 280
NQLSSPSLGFDGLPGRRRKKRTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQ    281 - 350
KEKRINPCSAAPMLPSPGKPASYSPHMVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGG    351 - 420
GGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP               421 - 479
//

Text Mined References (51)

PMID Year Title