Property Summary

NCBI Gene PubMed Count 38
PubMed Score 66.39
PubTator Score 45.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.3e-04
cutaneous lupus erythematosus 1057 1.3e-03
osteosarcoma 7950 2.2e-03
medulloblastoma, large-cell 6241 9.4e-03
colon cancer 1478 4.6e-02
Disease Target Count Z-score Confidence
Obesity 678 0.0 3.0
Disease Target Count Z-score Confidence
Gastroschisis 11 3.539 1.8
Hirschsprung's disease 46 3.479 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.400 4.6e-02
cutaneous lupus erythematosus -1.600 1.3e-03
medulloblastoma, large-cell 1.600 9.4e-03
osteosarcoma 1.675 2.2e-03
psoriasis -1.600 1.3e-04

Gene RIF (15)

AA Sequence

MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVG      1 - 70
ESSRAFPAPAQEPRFRQAASSCSLSSPESLPCTNGDSHGAKPSASSPSDQATSASSSANFTEIDEASASS     71 - 140
EPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELE    141 - 210
KEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAFQP               211 - 269
//

Text Mined References (39)

PMID Year Title