Property Summary

NCBI Gene PubMed Count 37
Grant Count 15
R01 Count 6
Funding $745,898.25
PubMed Score 63.68
PubTator Score 45.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus -1.600 0.001
psoriasis -1.600 0.000
osteosarcoma 1.675 0.002
medulloblastoma, large-cell 1.600 0.009
colon cancer 1.400 0.046

Gene RIF (14)

PMID Text
26467157 HOXB5 may be an important regulator of the Wnt/beta-catenin signalling pathway, thereby contributing to gastric cancer progression and metastasis.
25999793 HOXB5 acts as a positive modulator by promoting cell proliferative response and invasiveness in ER-positive breast cancer.
25703667 Roles of Hoxb5 in the development of vagal and trunk neural crest cells.
24189625 Overexpression of HoxB5 enhances blood vessel perfusion in vivo by up-regulation of MCP-1 and IL-6 as well as in enhanced leucocyte infiltration and blood vessel remodelling.
23438671 HOXB5 and HOXB8 are frequently expressed in ovarian serous carcinoma, with anatomic site-related differences for cytoplasmic staining. HOXB5 may be affected by chemotherapy in effusions.
22768238 A miRNA 7-binding single nucleotide polymorphism (1010A/G) located within 3'-UTR of HOXB5 is associated with gene expression and may be a promising prognostic factor for bladder cancer.
22648184 The findings for HOXB5 and PHOX2B provide supportive evidence that genes regulating ENCC proliferation, migration and differentiation could be risk factors for Hirschsprung's disease
22603795 HOXB5, HOXB6, and HOXB7 are activated in Barrett esophagus, and the midcluster HOXB gene signature in BE most resembled the colon rather than other GI epithelia.
22484627 Single nucleotide polymorphism in HOXB5 gene is associated with childhood obesity.
21677782 Data show that human HOXB5 binds to the promoter region 5' upstream of the binding site of NKX2-1 and regulates RET expression.
More...

AA Sequence

MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVG      1 - 70
ESSRAFPAPAQEPRFRQAASSCSLSSPESLPCTNGDSHGAKPSASSPSDQATSASSSANFTEIDEASASS     71 - 140
EPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELE    141 - 210
KEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAFQP               211 - 269
//

Text Mined References (38)

PMID Year Title
26467157 2015 HOXB5 induces invasion and migration through direct transcriptional up-regulation of ?-catenin in human gastric carcinoma.
25999793 2015 HOXB5 Promotes the Proliferation and Invasion of Breast Cancer Cells.
25703667 2015 Roles of Hoxb5 in the development of vagal and trunk neural crest cells.
25416956 2014 A proteome-scale map of the human interactome network.
24189625 2014 The transcription factor HoxB5 stimulates vascular remodelling in a cytokine-dependent manner.
23438671 2013 HOXB8 expression in ovarian serous carcinoma effusions is associated with shorter survival.
22768238 2012 A microRNA-7 binding site polymorphism in HOXB5 leads to differential gene expression in bladder cancer.
22648184 2012 Hirschsprung's disease and variants in genes that regulate enteric neural crest cell proliferation, migration and differentiation.
22603795 2012 Evidence for a functional role of epigenetically regulated midcluster HOXB genes in the development of Barrett esophagus.
22484627 2012 A genome-wide association meta-analysis identifies new childhood obesity loci.
More...