Property Summary

NCBI Gene PubMed Count 626
PubMed Score 10115.36
PubTator Score 4323.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 4.5471706237832E-16
Breast cancer 3099 7.06815486587965E-16
non-small cell lung cancer 2798 4.47511348307808E-15
malignant mesothelioma 3163 1.49099488320598E-8
cystic fibrosis 1670 1.79948077560303E-7
ovarian cancer 8492 1.86824096064504E-7
ductal carcinoma in situ 1745 6.86468623585135E-6
psoriasis 6685 2.00011819765859E-5
invasive ductal carcinoma 2950 6.06765699375623E-5
breast carcinoma 1614 4.1791864958607E-4
ulcerative colitis 2087 0.00163548100802679
group 3 medulloblastoma 2254 0.00214627623053771
medulloblastoma, large-cell 6234 0.00214663112107788
nasopharyngeal carcinoma 1056 0.00771971581082664
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0136988495703989
Down syndrome 548 0.0299357507086031
lung cancer 4473 0.0323012535206264
fibroadenoma 557 0.0475436209106971

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -3.200 0.000
psoriasis -2.500 0.000
group 3 medulloblastoma -2.100 0.002
cystic fibrosis 2.251 0.000
medulloblastoma, large-cell -2.300 0.002
autosomal dominant Emery-Dreifuss muscul... 1.059 0.014
non-small cell lung cancer -1.310 0.000
lung cancer -1.500 0.032
breast carcinoma -1.600 0.000
fibroadenoma -1.300 0.048
lung adenocarcinoma -1.200 0.000
invasive ductal carcinoma -3.900 0.000
nasopharyngeal carcinoma 1.100 0.008
Breast cancer -2.300 0.000
ductal carcinoma in situ -3.500 0.000
ulcerative colitis 1.900 0.002
ovarian cancer -1.600 0.000
Down syndrome 1.100 0.030

Synonym

Accession P09038 A4LBB8 O00527 P78443 Q16443 Q5PY50 Q7KZ11 Q7KZ72 Q9UC54 Q9UCS5 Q9UCS6 FGF-2
Symbols BFGF
FGFB
FGF-2
HBGF-2

Gene

PANTHER Protein Class (2)

PDB

1BAS   1BFB   1BFC   1BFF   1BFG   1BLA   1BLD   1CVS   1EV2   1FGA   1FQ9   1II4   1IIL   2BFH   2FGF   2M49   4FGF   4OEE   4OEF   4OEG  

  Ortholog (8)

 GWAS Trait (1)

Gene RIF (560)

PMID Text
27097314 FGF-2, VEGF-A, and HIV-Tat, may affect the glomerular filtration barrier in HIV+ children through the induction of synergistic changes in Rho-A and Src activity
26824699 BFGF overexpression is a potential indicator of worse prognosis for patients with operable non-small- and small- cell lung carcinomas. (Meta-analysis)
26823724 Suggest that miR-195, a tumor suppressor miRNA, contributes to the lung metastasis of HCC by negatively regulating FGF2 and VEGFA expression.
26798059 these data demonstrate that FGF-2 priming enhances the angiogenic potential of SHED through the secretion of both HGF and VEGF.
26729092 The function of bFGF is not only related to the neuroprotective and neurotrophic effect but also involved in the inhibition of excessive astrogliosis and glial scarring after neuronal injury.
26719333 Collectively, these studies show that FGF signaling up-regulates expression of alphaA-crystallin both directly and indirectly via up-regulation of c-Maf.
26712576 The administration of bFGF alone or in combination with VEGF improved the quality of postgraft human ovarian tissue, though VEGF, regardless of different concentrations, did not influence effect of bFGF.
26655277 FGF2 monoclonal antibody inhibited angiogenesis in HUVEC cell cultures.
26644005 LTBP-2 and FGF-2 are co-localized in fibrotic human keloid and hypertrophic scar.
26637527 FGF specifies hepatic fate at least in large part by inducing expression of NKD1 to transiently suppress the canonical WNT pathway.
More...

AA Sequence

MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRT      1 - 70
EERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSIT     71 - 140
TLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGV    141 - 210
CANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAIL    211 - 280
FLPMSAKS                                                                  281 - 288
//

Text Mined References (636)

PMID Year Title
27097314 2016 Circulating Fibroblast Growth Factor-2, HIV-Tat, and Vascular Endothelial Cell Growth Factor-A in HIV-Infected Children with Renal Disease Activate Rho-A and Src in Cultured Renal Endothelial Cells.
26824699 2016 Prognostic Value of Basic Fibroblast Growth Factor (bFGF) in Lung Cancer: A Systematic Review with Meta-Analysis.
26823724 2015 MiR-195 is a key negative regulator of hepatocellular carcinoma metastasis by targeting FGF2 and VEGFA.
26798059 2016 Priming Dental Pulp Stem Cells With Fibroblast Growth Factor-2 Increases Angiogenesis of Implanted Tissue-Engineered Constructs Through Hepatocyte Growth Factor and Vascular Endothelial Growth Factor Secretion.
26729092 2015 The Role of bFGF in the Excessive Activation of Astrocytes Is Related to the Inhibition of TLR4/NF?B Signals.
26719333 2016 Regulation of c-Maf and ?A-Crystallin in Ocular Lens by Fibroblast Growth Factor Signaling.
26712576 2016 bFGF and VEGF improve the quality of vitrified-thawed human ovarian tissues after xenotransplantation to SCID mice.
26655277 2016 Blocking FGF2 with a new specific monoclonal antibody impairs angiogenesis and experimental metastatic melanoma, suggesting a potential role in adjuvant settings.
26644005 2016 Co-localization of LTBP-2 with FGF-2 in fibrotic human keloid and hypertrophic scar.
26637527 2015 FGF2 mediates hepatic progenitor cell formation during human pluripotent stem cell differentiation by inducing the WNT antagonist NKD1.
More...