Property Summary

NCBI Gene PubMed Count 27
PubMed Score 25.06
PubTator Score 17.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 5.10196685544776E-11
glioblastoma 5572 2.34212017154598E-4
medulloblastoma, large-cell 6234 3.48373830816825E-4
psoriasis 6685 4.18430773866878E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00564086160068475
atypical teratoid / rhabdoid tumor 4369 0.0136216464387294
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0171469608955422
cutaneous lupus erythematosus 1056 0.0211520725859726
group 3 medulloblastoma 2254 0.0265836252267769
Disease Target Count Z-score Confidence
Osteoporosis 259 0.0 2.0
Disease Target Count Z-score Confidence
VACTERL association 23 4.062 2.0
Esophageal atresia 25 3.174 1.6

Expression

Synonym

Accession P09017
Symbols HOX3
cp19
HOX3E

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (8)

PMID Text
22298821 HOXC4 homeoprotein expands human hematopoietic immature cells by 3 to 6 times ex vivo and significantly improves the level of in vivo engraftment.
20855884 Esr1 bind to and activate the HOXC4 promoter to potentiate HoxC4-mediated AID induction, immunoglobulin class switch and somatic hypermutation.
19363484 HoxC4 directly activates the Aicda promoter
19236766 Human cytomegalovirus downregulates while all-trans retinoic acid upregulates expression of hoxc4 and hoxc6 in lymphocytic progenitor cells.
16215934 Observational study of gene-disease association. (HuGE Navigator)
15674412 The HOXC4 expression was clearly detected in all inv(7) positive patients.
15252056 The hs1,2mediated enhancement of V(H) and C(H) promoter-driven transcription as induced by HoxC4 and Oct-1/Oct-2 suggests an important role of these homeodomain proteins in the overall regulation of the IgH locus expression.
12672812 Selective inhibition of class switching to IgG and IgE by recruitment of this and Oct-1 proteins and Ku70/Ku86 to newly identified ATTT cis-elements.

AA Sequence

MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCT      1 - 70
SLQGPGNSRGHGPAQAGHHHPEKSQSLCEPAPLSGASASPSPAPPACSQPAPDHPSSAASKQPIVYPWMK     71 - 140
KIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMK    141 - 210
WKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL                    211 - 264
//

Text Mined References (28)

PMID Year Title
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22298821 2012 HOXC4 homeoprotein efficiently expands human hematopoietic stem cells and triggers similar molecular alterations as HOXB4.
20855884 2010 Estrogen receptors bind to and activate the HOXC4/HoxC4 promoter to potentiate HoxC4-mediated activation-induced cytosine deaminase induction, immunoglobulin class switch DNA recombination, and somatic hypermutation.
19363484 2009 HoxC4 binds to the promoter of the cytidine deaminase AID gene to induce AID expression, class-switch DNA recombination and somatic hypermutation.
19236766 2009 [Effect of human cytomegalovirus infection on the expression of hoxc4 and hoxc6 genes in the proliferation of lymphocytic progenitor cells].
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16582099 2006 The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...