Property Summary

NCBI Gene PubMed Count 27
PubMed Score 26.32
PubTator Score 17.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Protein-protein Interaction (6)

Gene RIF (8)

AA Sequence

MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCT      1 - 70
SLQGPGNSRGHGPAQAGHHHPEKSQSLCEPAPLSGASASPSPAPPACSQPAPDHPSSAASKQPIVYPWMK     71 - 140
KIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMK    141 - 210
WKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL                    211 - 264
//

Text Mined References (28)

PMID Year Title