Property Summary

NCBI Gene PubMed Count 40
Grant Count 244
R01 Count 110
Funding $49,160,638.72
PubMed Score 1144.55
PubTator Score 178.22

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P09012 U1 snRNP A
Symbols U1A
Mud1
U1-A

Gene

PDB

3PGW   1AUD   1DRZ   1DZ5   1FHT   1M5K   1M5O   1M5P   1M5V   1NU4   1OIA   1SJ3   1SJ4   1SJF   1U6B   1URN   1VBX   1VBY   1VBZ   1VC0   1VC5   1VC6   1ZZN   2A3J   2NZ4   2OIH   2OJ3   2U1A   3BO2   3BO3   3BO4   3CUL   3CUN   3EGZ   3G8S   3G8T   3G96   3G9C   3HHN   3IIN   3IRW   3IWN   3K0J   3L3C   3MUM   3MUR   3MUT   3MUV   3MXH   3P49   3R1H   3R1L   3UCU   3UCZ   3UD3   3UD4   3UTR   4C4W   4PR6   4PRF   4W90   4W92   4YB1   5DDO   5DDP   5DDQ   5DDR   5FJ4  

Gene RIF (11)

PMID Text
25496916 Small nuclear ribonucleoprotein polypeptide A (SNRPA) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24362020 a new mechanism for regulating SMN levels and provides new insight into the roles of U1A in 3' processing of mRNAs.
23166591 Small nuclear ribonucleoprotein polypeptide A (SNRPA) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21419778 An analysis of the kinetic data suggests three phases of U1A-SL2 RNA complex dissociation with time scales of approximately 100 mus, approximately 50 ms, and approximately 2 s. We propose that the first step of dissociation is a fast rearrangement of the complex to form a loosely bound complex.
21384338 structural analysis of U1A protein-stem loop 2 RNA recognition
21298455 study shows that the yellow fever virus (YFV) NS5 protein is able to interact with U1A, a protein involved in splicing and polyadenylation; a region between amino acids 368 and 448 was identified as the site of interaction of the NS5 protein with U1A
18854154 Knockdown of small nuclear ribonucleoprotein polypeptide A (SNRPA) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17942741 Functional U1A site in a cellular gene and of a single gene containing two dissimilar elements that inhibit nuclear polyadenylation.
17507659 Identification of PSF, p54(nrb), PTB, and U1A as proteins specifically bound to the COX-2 polyadenylation signal upstream sequence elements .
15890361 13)C NMR relaxation studies of base and ribose dynamics for the RNA internal loop target of human U1A protein located within the 3'-untranslated region (3'-UTR) of the mRNA coding for U1A itself
More...

AA Sequence

MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALR      1 - 70
SMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP     71 - 140
VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHIL    141 - 210
FLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFA    211 - 280
KK                                                                        281 - 282
//

Text Mined References (48)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24362020 2014 U1A regulates 3' processing of the survival motor neuron mRNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21419778 2011 Multistep kinetics of the U1A-SL2 RNA complex dissociation.
21384338 2011 U1A protein-stem loop 2 RNA recognition: prediction of structural differences from protein mutations.
More...