Property Summary

NCBI Gene PubMed Count 116
Grant Count 123
R01 Count 67
Funding $9,422,303.05
PubMed Score 665.00
PubTator Score 565.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession P08962 F8VZE2 Q5TZP3 Q8N6Z9 Q9UCG6
Symbols MLA1
ME491
LAMP-3
OMA81H
TSPAN30

Gene

Gene RIF (169)

PMID Text
26242181 CD163(+) TAMs in oral premalignant lesions coexpress CD163 and STAT1, suggesting that the TAMs in oral premalignant lesions possess an M1 phenotype in a Th1-dominated micromilieu.
26213230 These findings indicate that rhTIMP-1 promotes clonogenic expansion and survival in human progenitors via the activation of the CD63/PI3K/pAkt signaling pathway
26109641 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
26001794 Our findings reveal that elevated levels of TIMP-1 impact on neutrophil homeostasis via signaling through CD63.
25973004 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25973004 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25973004 HIV-1 Nef induces release of CD63 (MAL-dependent exosome marker) from Jurkat T cells transfected with DNA constructs coding for Nef-GFP
25973004 siRNA knockdown of CD63 in U1/HIV-1 cells (chronically infected monocytoid cells harboring 2 integrated copies of HIV provirus per cell) decreases CA (p24) levels in supernatants but does not affect intracellular CA (p24) levels
25973004 siRNA knockdown of CD63 in U1/HIV-1 cells (chronically infected monocytoid cells harboring 2 integrated copies of HIV provirus per cell) decreases CA (p24) levels in supernatants but does not affect intracellular CA (p24) levels
25973004 siRNA knockdown of CD63 in U1/HIV-1 cells (chronically infected monocytoid cells harboring 2 integrated copies of HIV provirus per cell) decreases CA (p24) levels in supernatants but does not affect intracellular CA (p24) levels
More...

AA Sequence

MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFV      1 - 70
GCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQ     71 - 140
ADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAA    141 - 210
LGIAFVEVLGIVFACCLVKSIRSGYEVM                                              211 - 238
//

Text Mined References (124)

PMID Year Title
27114500 2016 Exosomes surf on filopodia to enter cells at endocytic hot spots, traffic within endosomes, and are targeted to the ER.
26242181 2015 Tumor-associated macrophages in oral premalignant lesions coexpress CD163 and STAT1 in a Th1-dominated microenvironment.
26213230 2015 The tissue inhibitor of metalloproteinases 1 increases the clonogenic efficiency of human hematopoietic progenitor cells through CD63/PI3K/Akt signaling.
26001794 2015 TIMP-1 signaling via CD63 triggers granulopoiesis and neutrophilia in mice.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25658293 2015 In Sweet Harmony: CD63 and HIV-1.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25354204 2015 Tetraspanin CD63 acts as a pro-metastatic factor via ?-catenin stabilization.
25312088 2014 Investigation of membrane protein-protein interactions using correlative FRET-PLA.
25297946 2015 Pro-thrombotic effect of exercise in a polluted environment: a P-selectin- and CD63-related platelet activation effect.
More...