Property Summary

NCBI Gene PubMed Count 122
PubMed Score 710.89
PubTator Score 565.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.300 6.4e-06
Astrocytoma, Pilocytic 1.400 1.2e-10
atypical teratoid / rhabdoid tumor 1.200 2.9e-06
diabetes mellitus -1.300 5.6e-03
ependymoma 1.200 1.5e-14
glioblastoma 1.200 4.9e-10
mucosa-associated lymphoid tissue lympho... 1.338 2.8e-02
ovarian cancer -1.100 2.6e-03
subependymal giant cell astrocytoma 1.873 1.5e-03

Gene RIF (129)

AA Sequence

MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFV      1 - 70
GCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQ     71 - 140
ADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAA    141 - 210
LGIAFVEVLGIVFACCLVKSIRSGYEVM                                              211 - 238
//

Text Mined References (130)

PMID Year Title