Property Summary

NCBI Gene PubMed Count 30
PubMed Score 112.17
PubTator Score 139.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.179 2.3e-05
adult high grade glioma 1.700 2.5e-03
astrocytic glioma 2.800 3.1e-03
Astrocytoma, Pilocytic 1.600 6.9e-06
atypical teratoid / rhabdoid tumor 1.600 1.5e-02
Breast cancer 1.200 1.3e-03
breast carcinoma -1.700 5.5e-03
ductal carcinoma in situ -2.000 1.4e-03
ependymoma 2.000 4.2e-02
fibroadenoma -2.500 1.3e-02
glioblastoma 1.700 1.2e-04
invasive ductal carcinoma -2.100 6.5e-03
malignant mesothelioma -1.500 6.0e-06
oligodendroglioma 2.200 4.7e-03

 GWAS Trait (1)

Gene RIF (13)

AA Sequence

MARRAGGARMFGSLLLFALLAAGVAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKSLEPSSPSPLG      1 - 70
TAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK                        71 - 121
//

Text Mined References (31)

PMID Year Title