Property Summary

NCBI Gene PubMed Count 29
Grant Count 90
R01 Count 48
Funding $16,473,216.45
PubMed Score 110.78
PubTator Score 139.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
astrocytic glioma 2.800 0.003
posterior fossa group A ependymoma 2.100 0.000
oligodendroglioma 2.200 0.005
glioblastoma 2.000 0.002
atypical teratoid/rhabdoid tumor 1.700 0.003
adrenocortical carcinoma -1.179 0.000
breast carcinoma -1.700 0.005
fibroadenoma -2.500 0.013
adult high grade glioma 1.700 0.003
pilocytic astrocytoma 1.600 0.000
ductal carcinoma in situ -2.000 0.001
invasive ductal carcinoma -2.100 0.007
Breast cancer 1.200 0.001

Synonym

Accession P08949 Q96A06 Q96HH5
Symbols

Gene

NMB

PDB

1C98   1C9A  

Gene RIF (12)

PMID Text
23879873 Rs2292462 was associated with left ventricular hypertrophy in type 2 diabetic patients.
21527296 There was no association between eating behaviour traits, or anthropometric variables, and NMB p.P73T polymorphism.
20010906 TT genotype of the NMB rs3809508 polymorphism was associated with a higher risk of obesity and moreover, the effects of this polymorphism on anthropometric values were influenced by the maternal educational level.
20010906 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18271693 No significant differences in the genotype distribution were demonstrated between normal weight and overweight/obese subjects
18271693 Observational study of gene-disease association. (HuGE Navigator)
17766645 REsults describe the expression of neuromedin B in adipose tissue and its regulation by changes in energy balance.
17299381 Observational study of gene-disease association. (HuGE Navigator)
15585758 Associated with eating behaviors
15528253 NMB and its receptor are coexpressed by proliferating cells in which they act in an autocrine fashion with similar and modest potency in both normal and malignant colonic epithelial cells.
More...

AA Sequence

MARRAGGARMFGSLLLFALLAAGVAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKSLEPSSPSPLG      1 - 70
TAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK                        71 - 121
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25123163 2014 Itch-associated peptides: RNA-Seq and bioinformatic analysis of natriuretic precursor peptide B and gastrin releasing peptide in dorsal root and trigeminal ganglia, and the spinal cord.
24092425 2013 Anti-EGFR therapy combined with neuromedin B receptor blockade induces the death of DAOY medulloblastoma cells.
24054546 2013 Functional bombesin receptors in urinary tract of rats and human but not of pigs and mice, an in vitro study.
23879873 2013 Genetic variants predicting left ventricular hypertrophy in a diabetic population: a Go-DARTS study including meta-analysis.
23317790 2013 The role of bombesin and bombesin-related peptides in the short-term control of food intake.
21712056 2011 Bombesin receptor subtype-3 agonists stimulate the growth of lung cancer cells and increase EGF receptor tyrosine phosphorylation.
21527296 2011 Effects of neuromedin-? on caloric compensation, eating behaviours and habitual food intake.
21140465 Biochemical specificity of von Economo neurons in hominoids.
21140464 The von Economo neurons in apes and humans.
More...