Property Summary

Ligand Count 43
NCBI Gene PubMed Count 111
PubMed Score 301.69
PubTator Score 175.66

Knowledge Summary

Patent (22,434)


  Differential Expression (6)

Disease log2 FC p
lung cancer -3.300 4.9e-06
lung adenocarcinoma -1.200 1.2e-03
lung carcinoma -5.100 9.1e-42
non-small cell lung cancer -1.199 3.6e-12
psoriasis -2.500 3.4e-14
sarcoidosis -1.200 2.9e-02

Gene RIF (100)

AA Sequence

ADKDFCQEKQVAYCPSGKPEGLNYACLTHSGYGDGSD                                    2311 - 2347

Text Mined References (113)

PMID Year Title