Property Summary

NCBI Gene PubMed Count 201
Grant Count 42
R01 Count 16
Funding $12,677,882.38
PubMed Score 252.84
PubTator Score 350.23

Knowledge Summary

Patent (7,061)

TINX Plot

  Disease Relevance (81)

Disease Z-score Confidence
Attention deficit hyperactivity disorder 156 5.765 2.9
Gilles de la Tourette syndrome 47 3.758 1.9
Schizophrenia 501 3.358 1.7
African tick-bite fever 2 3.186 1.6
Dyscalculia 6 3.055 1.5
Acquired metabolic disease 267 2.0
Acute exacerbation of asthma 14
Administration of Local Anesthetic Nerve... 14 
Allergic Reactions 7
Asthma 349
Asthma management 20
Bronchiectasis 29
Bronchitis 44
Cardiomegaly 66
Cerebral ischemia 12
Cerebrovascular Occlusion 5
Cerebrovascular disease 231
Conscious sedation 10
Dermal Necrosis 6
Diagnostic Test for Pheochromocytoma 6
Disease of mental health 22 1.0
Disorder of blood vessel 4
Dyspnea 8
Epilepsy 346
Exacerbation of asthma 11
Fibrosis 40
Heart Diseases 42
Hydrolethalus syndrome 128
Hypertension Secondary to Pheochromocyto... 6 
Hypertensive Emergencies 10
Hypertensive disease 193
Hypertensive disorder 58
Hypotension 53
Increased Intraocular Pressure after Ocu... 3 
Local anesthesia, by infiltration 14
Low blood pressure 9
Muscle Spasticity of Cerebral Origin 8
Muscle spasticity of spinal origin 8
Nasal congestion 24
Nasal discharge 26
Ocular Itching 4
Ocular hypertension 27
Open-angle glaucoma 26
Opioid withdrawal 2
Orthostatic hypotension 9
Panic disorder 55
Parkinson's disease 364
Paroxysmal hypertension 6
Percutaneous coronary intervention 10
Peripheral vascular disease 90
Persistent pulmonary hypertension of the... 8 
Pheochromocytoma 22
Prevention of Cerebral Thrombosis 29
Prevention of Hypertension in Pheochromo... 6 
Pulmonary emphysema 34
Red eye 7
Rosacea 18
Severe pain 12
Spasticity 26
Subacute Stent Thrombosis Prevention 5
Type 2 diabetes mellitus 189 2.0
Wheezing 7
adult high grade glioma 2,148
anaphylaxis 11
atypical teratoid/rhabdoid tumor 1,095
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
ependymoma 2,514
fibroadenoma 557
glioblastoma 5,572
group 3 medulloblastoma 2,254
invasive ductal carcinoma 2,950
lung cancer 4,466
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
ovarian cancer 8,484
pilocytic astrocytoma 3,086
pituitary cancer 1,972
primitive neuroectodermal tumor 3,031
psoriasis 6,685
uncontrolled asthma 67

Expression

  Differential Expression (19)

Disease log2 FC p
oligodendroglioma -1.400 0.001
uncontrolled asthma 1.200 0.002
psoriasis -1.100 0.000
ependymoma -1.300 0.001
glioblastoma -2.100 0.000
group 3 medulloblastoma -2.300 0.000
cystic fibrosis -3.322 0.000
atypical teratoid/rhabdoid tumor -1.200 0.001
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.600 0.046
Hydrolethalus syndrome -2.694 0.044
lung cancer -1.100 0.003
fibroadenoma -1.500 0.021
adult high grade glioma -1.700 0.000
pilocytic astrocytoma -2.400 0.000
ductal carcinoma in situ -1.900 0.001
invasive ductal carcinoma -3.100 0.001
ovarian cancer -1.600 0.000
pituitary cancer 2.000 0.019

MLP Assay (24)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434953 screening 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
504410 confirmatory 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki Set 2
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
More...

Gene RIF (194)

PMID Text
27049325 Risk alleles for 6 loci increased glucose levels from birth to 5 years of age (ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2
26427149 Common polymorphisms in the ADRA2A gene are not associated with orthostatic hypotension risk in Chinese.
26410938 Genetic association of ADRA2A single nucleotide polymorphism with metabolic syndrome and high level insulin among the Tatars
26234518 The ADRA2A C-1291G and COMT Val158Met genotypes and sex interact in predicting detection and perception of emotional valence in facial expressions
26058836 ADRA2a is associated with heart rate recovery after exercise.
25978426 Study is in line with previous reports of an association between ADRA2A gene variants and general reaction time variability during response selection tasks
25926111 The rs10885122G>T polymorphism of the ADRA2A gene was not associated with type 2 diabetes mellitus in Euro-Brazilians, and carriers of the T allele had lower body weight in the presence of type 2 diabetes mellitus.
25163438 Results show that ADRA2A genotype was associated with clozapine-induced sialorrhea
25110082 The accuracy of prediction for breast cancer relapse based solely on the expression of ADRA2A gene is high.
24723553 6.3-kb alpha2A-AR variant is associated with increased platelet reactivity to epinephrine and has an additive effect along with CYP2C19*2 loss-of-function allele on P2Y12-mediated platelet responses in patients with stable angina on dual antiplatelet therapy
More...

AA Sequence

MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFTSRALKAPQNL      1 - 70
FLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIE     71 - 140
YNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCL    141 - 210
IMILVYVRIYQIAKRRTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEP    211 - 280
APAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPG    281 - 350
EERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS    351 - 420
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV                                            421 - 450
//

Text Mined References (201)

PMID Year Title
27049325 2016 Risk Alleles in/near ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2 Elevate Plasma Glucose Levels at Birth and in Early Childhood: Results from the FAMILY Study.
26427149 2015 Association between Common Genetic Variants of ?2A-, ?2B-, and ?2C-Adrenergic Receptors and Orthostatic Hypotension.
26410938 2015 [Genetic Association of ADRA2A and ADRB3 Genes with Metabolic Syndrome among the Tatars].
26234518 2016 Perception of emotion in facial stimuli: The interaction of ADRA2A and COMT genotypes, and sex.
26058836 2015 Genetic variation in alpha2-adrenoreceptors and heart rate recovery after exercise.
25978426 2015 A Population Based Study of the Genetic Association between Catecholamine Gene Variants and Spontaneous Low-Frequency Fluctuations in Reaction Time.
25926111 2015 The rs10885122 polymorphism of the adrenoceptor alpha 2A (ADRA2A) gene in Euro-Brazilians with type 2 diabetes mellitus.
25163438 2014 Polymorphism in alpha 2A adrenergic receptor gene is associated with sialorrhea in schizophrenia patients on clozapine treatment.
25110082 2014 On statistical relationship between ADRA2A expression and the risk of breast cancer relapse.
24723553 2014 ?2A-Adrenergic receptor polymorphism potentiates platelet reactivity in patients with stable coronary artery disease carrying the cytochrome P450 2C19*2 genetic variant.
More...