Property Summary

Ligand Count 375
NCBI Gene PubMed Count 207
PubMed Score 261.40
PubTator Score 350.23

Knowledge Summary

Patent (7,061)


  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Familial partial lipodystrophy 12 0.0 5.0
Disease Target Count Z-score Confidence
Gilles de la Tourette syndrome 47 3.727 1.9
African tick-bite fever 2 3.211 1.6


  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.700 3.5e-04
Astrocytoma, Pilocytic -2.400 2.3e-08
atypical teratoid / rhabdoid tumor -1.100 1.3e-02
cystic fibrosis -3.322 7.2e-07
ductal carcinoma in situ -1.900 1.1e-03
ependymoma -1.300 1.0e-03
fibroadenoma -1.500 2.1e-02
glioblastoma -2.100 1.4e-08
group 3 medulloblastoma -2.300 1.3e-04
Hydrolethalus syndrome -2.694 4.4e-02
invasive ductal carcinoma -3.100 8.8e-04
lung cancer -1.100 2.7e-03
medulloblastoma, large-cell -1.600 3.5e-04
oligodendroglioma -1.400 8.6e-04
ovarian cancer -1.600 3.5e-06
pituitary cancer 2.000 1.9e-02
primitive neuroectodermal tumor -1.600 4.6e-02
psoriasis -1.100 1.2e-05
uncontrolled asthma 1.200 2.5e-03

 CSPA Cell Line (1)

Gene RIF (199)

AA Sequence

LNPVIYTIFNHDFRRAFKKILCRGDRKRIV                                            421 - 450

Text Mined References (207)

PMID Year Title