Property Summary

NCBI Gene PubMed Count 201
PubMed Score 252.84
PubTator Score 350.23

Knowledge Summary

Patent (7,061)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
pilocytic astrocytoma 3086 1.01937691606158E-8
glioblastoma 5572 1.37312502953345E-8
cystic fibrosis 1670 7.22820464791191E-7
ovarian cancer 8492 3.46214705277584E-6
psoriasis 6685 1.18552764417434E-5
group 3 medulloblastoma 2254 1.30976949374547E-4
adult high grade glioma 2148 3.48555812765257E-4
medulloblastoma, large-cell 6234 3.50505386281723E-4
oligodendroglioma 2849 8.56429032607593E-4
invasive ductal carcinoma 2950 8.83631902693354E-4
ependymoma 2514 0.0010334487239891
ductal carcinoma in situ 1745 0.0011305576089164
atypical teratoid/rhabdoid tumor 1095 0.00146860734622368
uncontrolled asthma 67 0.00249713758977724
lung cancer 4473 0.00270629649497894
pituitary cancer 1972 0.0194808918324465
fibroadenoma 557 0.0211302012369423
Hydrolethalus syndrome 128 0.0440176850515453
primitive neuroectodermal tumor 3031 0.0464735343394739

Expression

  Differential Expression (19)

Disease log2 FC p
oligodendroglioma -1.400 0.001
uncontrolled asthma 1.200 0.002
psoriasis -1.100 0.000
ependymoma -1.300 0.001
glioblastoma -2.100 0.000
group 3 medulloblastoma -2.300 0.000
cystic fibrosis -3.322 0.000
atypical teratoid/rhabdoid tumor -1.200 0.001
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.600 0.046
Hydrolethalus syndrome -2.694 0.044
lung cancer -1.100 0.003
fibroadenoma -1.500 0.021
adult high grade glioma -1.700 0.000
pilocytic astrocytoma -2.400 0.000
ductal carcinoma in situ -1.900 0.001
invasive ductal carcinoma -3.100 0.001
ovarian cancer -1.600 0.000
pituitary cancer 2.000 0.019

Synonym

Accession P08913 B0LPF6 Q2I8G2 Q2XN99 Q86TH8 Q9BZK1
Symbols ADRA2
ADRAR
ZNF32
ADRA2R
ALPHA2AAR

Gene

PANTHER Protein Class (2)

PDB

1HLL   1HO9   1HOD   1HOF  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

  TechDev Info (1)

 CSPA Cell Line (1)

MLP Assay (24)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434953 screening 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
504410 confirmatory 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki Set 2
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
More...

Gene RIF (194)

PMID Text
27049325 Risk alleles for 6 loci increased glucose levels from birth to 5 years of age (ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2
26427149 Common polymorphisms in the ADRA2A gene are not associated with orthostatic hypotension risk in Chinese.
26410938 Genetic association of ADRA2A single nucleotide polymorphism with metabolic syndrome and high level insulin among the Tatars
26234518 The ADRA2A C-1291G and COMT Val158Met genotypes and sex interact in predicting detection and perception of emotional valence in facial expressions
26058836 ADRA2a is associated with heart rate recovery after exercise.
25978426 Study is in line with previous reports of an association between ADRA2A gene variants and general reaction time variability during response selection tasks
25926111 The rs10885122G>T polymorphism of the ADRA2A gene was not associated with type 2 diabetes mellitus in Euro-Brazilians, and carriers of the T allele had lower body weight in the presence of type 2 diabetes mellitus.
25163438 Results show that ADRA2A genotype was associated with clozapine-induced sialorrhea
25110082 The accuracy of prediction for breast cancer relapse based solely on the expression of ADRA2A gene is high.
24723553 6.3-kb alpha2A-AR variant is associated with increased platelet reactivity to epinephrine and has an additive effect along with CYP2C19*2 loss-of-function allele on P2Y12-mediated platelet responses in patients with stable angina on dual antiplatelet therapy
More...

AA Sequence

MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFTSRALKAPQNL      1 - 70
FLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIE     71 - 140
YNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCL    141 - 210
IMILVYVRIYQIAKRRTRVPPSRRGPDAVAAPPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEP    211 - 280
APAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPG    281 - 350
EERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS    351 - 420
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV                                            421 - 450
//

Text Mined References (201)

PMID Year Title
27049325 2016 Risk Alleles in/near ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2 Elevate Plasma Glucose Levels at Birth and in Early Childhood: Results from the FAMILY Study.
26427149 2015 Association between Common Genetic Variants of ?2A-, ?2B-, and ?2C-Adrenergic Receptors and Orthostatic Hypotension.
26410938 2015 [Genetic Association of ADRA2A and ADRB3 Genes with Metabolic Syndrome among the Tatars].
26234518 2016 Perception of emotion in facial stimuli: The interaction of ADRA2A and COMT genotypes, and sex.
26058836 2015 Genetic variation in alpha2-adrenoreceptors and heart rate recovery after exercise.
25978426 2015 A Population Based Study of the Genetic Association between Catecholamine Gene Variants and Spontaneous Low-Frequency Fluctuations in Reaction Time.
25926111 2015 The rs10885122 polymorphism of the adrenoceptor alpha 2A (ADRA2A) gene in Euro-Brazilians with type 2 diabetes mellitus.
25163438 2014 Polymorphism in alpha 2A adrenergic receptor gene is associated with sialorrhea in schizophrenia patients on clozapine treatment.
25110082 2014 On statistical relationship between ADRA2A expression and the risk of breast cancer relapse.
24723553 2014 ?2A-Adrenergic receptor polymorphism potentiates platelet reactivity in patients with stable coronary artery disease carrying the cytochrome P450 2C19*2 genetic variant.
More...