Property Summary

Ligand Count 129
NCBI Gene PubMed Count 30
PubMed Score 22.89
PubTator Score 18.55

Knowledge Summary

Patent (2,562)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.300 1.3e-04
ovarian cancer 1.200 1.8e-07

Gene RIF (15)

AA Sequence

MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLL      1 - 70
SLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRA     71 - 140
KRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMT    141 - 210
ILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTST    211 - 280
TGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAE    281 - 350
TEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP    351 - 420
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTV    421 - 490
NPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP                                491 - 532
//

Text Mined References (30)

PMID Year Title