Property Summary

NCBI Gene PubMed Count 30
Grant Count 4
Funding $500,375.33
PubMed Score 22.74
PubTator Score 18.55

Knowledge Summary

Patent (2,562)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.000
ovarian cancer 1.200 0.000

Synonym

Accession P08912 Q96RG7
Symbols HM5

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
588747 confirmatory 0 / 0 / 5 Human M5 PAM Extended Characterization CounterScreen (CRC)
623939 confirmatory 0 / 0 / 10 Chemical optimization of in vitro pharmacology and DMPK properties of the highly selective mAChR 4 (M4) Positive Allosteric Modulator (PAM) Series with Greatly Improved Human Receptor Activity (hM5 CounterScreen)
624037 screening 699 / 0 / 363432 Fluorescence-based cell-based primary high throughput screening assay to identify agonists of the human cholinergic receptor, muscarinic 5 (CHRM5)
624038 screening 1081 / 0 / 363050 Fluorescence-based cell-based primary high throughput screening assay to identify positive allosteric modulators (PAMs) of the human cholinergic receptor, muscarinic 5 (CHRM5)
624040 screening 2140 / 0 / 361991 Fluorescence-based cell-based primary high throughput screening assay to identify antagonists of the human cholinergic receptor, muscarinic 5 (CHRM5)
624103 summary 0 / 0 / 0 Summary of the probe development efforts to identify agonists of the human cholinergic receptor, muscarinic 5 (CHRM5)
743251 screening 1 / 0 / 0 Development of a novel orthosteric Muscarinic 5 (M5) antagonist possessing a hig degree of muscarinic subtype selectivity
743252 screening 1 / 0 / 0 Development of the first CNS penetrant Muscarinic 5 (M5) Positive Allosteric Modulator based on a novel non-isatin core

Gene RIF (15)

PMID Text
25375131 Cigarette smoking may contribute to this imbalance by affecting the polarization and survival of Th/Tregs through the up-regulation of MR3 and MR5.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19944766 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
17951979 the M(3)/M(5) subtypes appear to be the major contributor, leading to intracellular calcium mobilization from the internal store via an IP(3)-dependent pathway in the undifferentiated retinoblastoma cells.
More...

AA Sequence

MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQLKTVNNYYLL      1 - 70
SLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMNLLVISFDRYFSITRPLTYRA     71 - 140
KRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPLDECQIQFLSEPTITFGTAIAAFYIPVSVMT    141 - 210
ILYCRIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTST    211 - 280
TGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAE    281 - 350
TEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP    351 - 420
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLGYWLCYVNSTV    421 - 490
NPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP                                491 - 532
//

Text Mined References (30)

PMID Year Title
25375131 2014 Cigarette smoking promotes inflammation in patients with COPD by affecting the polarization and survival of Th/Tregs through up-regulation of muscarinic receptor 3 and 5 expression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19944766 2010 A pilot multivariate parallel ICA study to investigate differential linkage between neural networks and genetic profiles in schizophrenia.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
More...