Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.36
PubTator Score 10.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
active ulcerative colitis 1.143 1.4e-02
Astrocytoma, Pilocytic 1.800 5.4e-09
atypical teratoid / rhabdoid tumor -1.100 3.4e-02
Barrett's esophagus 1.200 1.7e-02
Breast cancer 1.100 2.2e-06
breast carcinoma 1.400 5.2e-25
colon cancer 2.200 1.4e-03
esophageal adenocarcinoma 1.300 1.8e-02
glioblastoma 1.100 3.5e-02
group 4 medulloblastoma 1.700 1.3e-02
interstitial cystitis -1.100 3.8e-03
intraductal papillary-mucinous adenoma (... 1.600 8.2e-04
intraductal papillary-mucinous carcinoma... 1.700 8.3e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.5e-02
invasive ductal carcinoma 1.100 3.5e-03
lung adenocarcinoma -1.100 8.0e-05
lung cancer 1.600 2.9e-03
lung carcinoma 1.300 1.1e-26
medulloblastoma, large-cell -2.400 5.1e-05
oligodendroglioma 2.000 5.1e-03
osteosarcoma -1.468 4.9e-04
ovarian cancer -1.600 7.4e-12
pancreatic cancer 1.200 7.2e-03
pediatric high grade glioma 1.200 7.6e-05
pituitary cancer -1.300 1.2e-04
primary pancreatic ductal adenocarcinoma 1.311 6.7e-03
psoriasis -2.700 1.4e-04
Rheumatoid arthritis 2.300 5.4e-04
tuberculosis -1.400 3.1e-04

Gene RIF (6)

AA Sequence

MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPL      1 - 70
IWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEK     71 - 140
QYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGG    141 - 210
NIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHV    211 - 280
KKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHE    281 - 350
SLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQV    351 - 420
EADLE                                                                     421 - 425
//

Text Mined References (16)

PMID Year Title