Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.14
PubTator Score 10.86

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P08910 Q53G48 Q53GU0 Q5FVD9 Q8TC79
Symbols HS1-2
LABH2
PHPS1-2

Gene

PANTHER Protein Class (1)

Gene RIF (4)

PMID Text
26989199 ABHD2 is highly expressed in spermatozoa, binds progesterone, and acts as a progesterone-dependent lipid hydrolase by depleting the endocannabinoid 2-arachidonoylglycerol (2AG) from plasma membrane.
25880496 ABHD2 gene single nucleotide polymorphisms, such as rs12442260 contribute to chronic obstructive pulmonary disease susceptibility in the Chinese Han population.
20007591 Patients with selective immunoglobulin (Ig)A deficiency have a highly significant increase of homozygousity of HS1.2 allele *1, with an increase of 2.6-fold; the HS1.2 polymorphism influences Ig seric production, but not IgG switch.
17980156 Our results showed that the ABHD2 was expressed in atherosclerotic lesions, and that the ABHD2 expression was significantly higher in the patients with UA than with SA.

AA Sequence

MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPL      1 - 70
IWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEK     71 - 140
QYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGG    141 - 210
NIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHV    211 - 280
KKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHE    281 - 350
SLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQV    351 - 420
EADLE                                                                     421 - 425
//

Text Mined References (14)

PMID Year Title
26989199 2016 Unconventional endocannabinoid signaling governs sperm activation via the sex hormone progesterone.
25880496 2015 Associations of ABHD2 genetic variations with risks for chronic obstructive pulmonary disease in a Chinese Han population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20007591 2009 Allele *1 of HS1.2 enhancer associates with selective IgA deficiency and IgM concentration.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17980156 2008 Elevated mature macrophage expression of human ABHD2 gene in vulnerable plaque.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...