Property Summary

NCBI Gene PubMed Count 325
Grant Count 931
R01 Count 502
Funding $151,633,617.6
PubMed Score 4839.17
PubTator Score 2166.02

Knowledge Summary

Patent (43,901)

Synonym

Accession P08908 Q6LAE7 5-HT-1A
Symbols G-21
5HT1a
PFMCD
5-HT1A
5-HT-1A
ADRBRL1
ADRB2RL1

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
567 screening 366 / 0 / 64559 Primary HTS assay for 5-Hydroxytryptamine (Serotonin) Receptor Subtype 1a (5HT1a) agonists
612 screening 416 / 0 / 61193 Primary HTS assay for 5-Hydroxytryptamine (Serotonin) Receptor Subtype 1a (5HT1a) antagonists
613 confirmatory 17 / 0 / 329 Dose Response assay for 5-Hydroxytryptamine (Serotonin) Receptor Subtype 1a (5HT1a) agonists
718 confirmatory 7 / 0 / 44 Dose Response assay for agonists of 5-Hydroxytryptamine (Serotonin) Receptor Subtype 1A (5HT1A)
755 confirmatory 25 / 0 / 19 Dose Response Cell Based Assay for Antagonists of the 5-Hydroxytryptamine Receptor Subtype 1A (5HT1A)
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (350)

PMID Text
26926882 A single-nucleotide polymorphism of the serotonin 1a receptor gene (HTR1A) has been designated rs6295.28 and found to be overrepresented in suicide and associated with a decreased responsiveness to antidepressants.
26866771 rs6295 [C]-allele protects against depressive mood in elderly endurance athletes
26845861 The data on the distribution of allele and genotype frequencies of the HTR1A, HTR2A, and HTR1B genes can be used to determine the associations of the identified markers with various forms of human aggressive behavior.
26609890 Also patients with a higher level of alexithymia and the HTR1A-G gene variant are more vulnerable to experiencing IFN-induced depressive symptoms
26544898 epistatic effects of 5HTR1A and 5HTR2A genes on suicidal behaviour were not significant
26408209 Our findings provide supportive evidence that genetic polymorphisms in SLC6A4 and HTR1A may influence the risk of SZ in Han Chinese individuals
26342283 Results reported here strongly support the role of 5-HT1A partial agonism as a means of restoring cognitive function following subchronic treatment with an NMDAR non-competitiave antagonist
26261165 No significant association was found between SNPs in HTR1A (rs6295), HTR2A (rs6311 and rs6313) and SLC6A4 and response to escitalopram in patients with major depressive disorder
26079129 IPO11-HTR1A is a significant risk gene region for attention deficit hyperactivity disorder in Caucasians.
26001668 mood disorders and HTR1A G allele variation, the C-1019G polymorphism of the transcriptional control region of the 5-HT1A receptor, independently predicted the incidence of IFN-induced depression in HCV patients.
More...

AA Sequence

MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAAIALERSLQNV      1 - 70
ANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITD     71 - 140
PIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPEDRSDPDACTISKDHGYTIYSTFGAFYIPLLL    141 - 210
MLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGA    211 - 280
VRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGII    281 - 350
MGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC    351 - 420
RQ                                                                        421 - 422
//

Text Mined References (332)

PMID Year Title
26926882 2016 The functional serotonin 1a receptor promoter polymorphism, rs6295, is associated with psychiatric illness and differences in transcription.
26866771 2015 rs6295 [C]-Allele Protects Against Depressive Mood in Elderly Endurance Athletes.
26845861 2015 [Comparative Analysis of Polymorphisms of the Serotonin Receptor Genes HTR1A, HTR2A, and HTR1B in Hadza and Datoga Males].
26609890 2015 Genetic Associations of Alexithymia in Predicting Interferon-Induced Depression in Chronic Hepatitis C.
26544898 2016 The impact of serotonin receptor 1A and 2A gene polymorphisms and interactions on suicide attempt and suicide risk in depressed patients with insufficient response to treatment--a European multicentre study.
26408209 2015 Common variants of HTR1A and SLC6A4 confer the increasing risk of Schizophrenia susceptibility: A population-based association and epistasis analysis.
26342283 2016 Prolonged reversal of the phencyclidine-induced impairment in novel object recognition by a serotonin (5-HT)1A-dependent mechanism.
26261165 2015 Association of serotonin transporter (SLC6A4) & receptor (5HTR1A, 5HTR2A) polymorphisms with response to treatment with escitalopram in patients with major depressive disorder: A preliminary study.
26079129 2015 Significant association between rare IPO11-HTR1A variants and attention deficit hyperactivity disorder in Caucasians.
26001668 2015 Serotonin gene polymorphisms and lifetime mood disorders in predicting interferon-induced depression in chronic hepatitis C.
More...