Property Summary

Ligand Count 2
NCBI Gene PubMed Count 347
PubMed Score 271.64
PubTator Score 675.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 4.116 2.1

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.012 1.4e-04
Astrocytoma, Pilocytic 1.500 2.2e-05
atypical teratoid / rhabdoid tumor -1.500 5.3e-03
Breast cancer -1.100 3.3e-06
colon cancer -2.400 6.3e-05
glioblastoma 1.200 4.8e-02
group 3 medulloblastoma -1.200 2.6e-02
intraductal papillary-mucinous adenoma (... 1.700 1.4e-02
invasive ductal carcinoma -1.500 6.9e-03
lung cancer -2.900 1.4e-03
lung carcinoma -1.300 6.1e-20
malignant mesothelioma 2.300 2.6e-06
medulloblastoma, large-cell -2.800 4.8e-07
non-small cell lung cancer -1.745 8.1e-17
osteosarcoma -2.039 3.5e-03
ovarian cancer -1.100 3.1e-02
pancreatic ductal adenocarcinoma liver m... -1.677 1.3e-03
Pick disease 1.400 1.4e-02
pituitary cancer -3.400 6.4e-08
primary Sjogren syndrome 1.200 3.5e-02
subependymal giant cell astrocytoma 2.163 5.1e-03
tuberculosis and treatment for 3 months -1.100 1.2e-03
ulcerative colitis -1.100 5.3e-05

Protein-protein Interaction (11)

Gene RIF (324)

AA Sequence

MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH      1 - 70
PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTP     71 - 140
SLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG    141 - 210
CGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIH    211 - 280
DAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN    281 - 350
ATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP    351 - 420
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR                          421 - 468
//

Text Mined References (348)

PMID Year Title