Property Summary

NCBI Gene PubMed Count 314
Grant Count 110
R01 Count 64
Funding $9,221,861.11
PubMed Score 257.99
PubTator Score 675.74

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P08887 A8KAE8 B2R6V4 Q16202 Q53EQ7 Q5FWG2 Q5VZ23 IL-6 receptor subunit alpha
Symbols IL6Q
gp80
CD126
IL6RA
IL6RQ
IL-6RA
IL-6R-1

Gene

PDB

1N2Q   1P9M   1N26   2ARW  

Gene RIF (290)

PMID Text
26997259 results provide evidence that two IL6R gene polymorphisms rs2228145 C and rs12083537 G are associated with poor lung function in patients with asthma. Furthermore, the rs2228145 A-C variant is associated with levels of sIL-6R and IgE.
26782593 While prior studies have found an association between PDE4D and IL6R polymorphisms and ischemic stroke, the results of this study suggest that this association may be different in a hypertensive population.
26714766 This is the first study to investigate the effects of functional two polymorphisms on IL-6 and IL-6R genes in a pediatric patient group with AA risk.
26699882 High serum IL-6R levels were associated with Chronic Spontaneous Urticaria.
26563755 Authors identified miR-125a as a direct regulator of IL-6R, and the genotype of rs12976445 might be a novel predictor of the development of DN in DM.
26424054 miR-125a-5p directly targets IL-6R and STAT3 expression in HEK-293T cells.
26359498 established that endogenous IL-6R of both human and murine origin is shed by ADAM17 in an induced manner, whereas constitutive release of endogenous IL-6R is largely mediated by ADAM10
26329582 findings identify TRAF3 and PTPN22 as inhibitors of IL-6R signaling in B cells and reveal a previously uncharacterized role for TRAF3 in the regulation of plasma cell differentiation
26205065 The serum levels of VEGF, IL-17, IL-10 and TNF-alpha were lower in the pregnant women with PE when compared with their normotensive peers, while the IL-6 levels were higher
26200663 obesity was a positive modulator of IL-6R and IL-6 expression in the adipose tissue which might be a contributory mechanism to induce metabolic inflammation.
More...

AA Sequence

MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSH      1 - 70
PSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTP     71 - 140
SLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQG    141 - 210
CGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIH    211 - 280
DAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSAN    281 - 350
ATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP    351 - 420
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR                          421 - 468
//

Text Mined References (315)

PMID Year Title
26997259 2016 The IL6R gene polymorphisms are associated with sIL-6R, IgE and lung function in Chinese patients with asthma.
26782593 2015 Association of phosphodiesterase 4D gene and interleukin-6 receptor gene polymorphisms with ischemic stroke in a Chinese hypertensive population.
26714766 2015 Polymorphisms in the IL-6 and IL-6R receptor genes as new diagnostic biomarkers of acute appendicitis: a study on two candidate genes in pediatric patients with acute appendicitis.
26699882 2015 IL-6 Transsignaling in Patients with Chronic Spontaneous Urticaria.
26563755 2015 Rs12976445 Polymorphism is Associated with Risk of Diabetic Nephropathy Through Modulating Expression of MicroRNA-125 and Interleukin-6R.
26424054 2015 MiR-125a-5p Decreases the Sensitivity of Treg cells Toward IL-6-Mediated Conversion by Inhibiting IL-6R and STAT3 Expression.
26359498 2015 Shedding of Endogenous Interleukin-6 Receptor (IL-6R) Is Governed by A Disintegrin and Metalloproteinase (ADAM) Proteases while a Full-length IL-6R Isoform Localizes to Circulating Microvesicles.
26329582 2015 The adaptor protein TRAF3 inhibits interleukin-6 receptor signaling in B cells to limit plasma cell development.
26205065 2016 Assessment of angiogenesis modulators in pregnant women with pre-eclampsia: a case-control study.
26200663 2015 Obesity Is a Positive Modulator of IL-6R and IL-6 Expression in the Subcutaneous Adipose Tissue: Significance for Metabolic Inflammation.
More...