Property Summary

NCBI Gene PubMed Count 106
Grant Count 88
R01 Count 61
Funding $18,540,318.26
PubMed Score 843.58
PubTator Score 216.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P08865 P11085 P12030 Q16471 Q6IPD1 Q6IPD2 Q6NSD1 Q6NXQ8 Q86VC0
Symbols SA
LBP
LRP
p40
67LR
ICAS
lamR
37LRP
LAMBR
LAMR1
LRP/LR
LBP/p40
NEM/1CHD4

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX   3BCH  

Gene RIF (67)

PMID Text
26545108 Knock-Down of the 37kDa/67kDa Laminin Receptor LRP/LR Impedes Telomerase Activity
26427016 High expression level of the laminin receptor is associated with Breast and Oesophageal Cancer.
26146125 Higher molecular weight Rpsa requires sumoylation to form.
26062445 Report discovery of new small molecules inhibiting 67 kDa laminin receptor interaction with laminin and cancer cell invasivness.
25840456 Mutations in the gene RPSA, which encodes ribosomal protein SA, cause more than half of the cases of isolated congenital asplenia. These disease-causing mutations lead to haploinsufficiency of RPSA. Review.
25800042 LR1 contributes to hypoxia-induced migration and invasion of trophoblast cells at least partly by mediating MMP-9
25778325 Suggest role for 67LR/mitogen activated protein kinase/DUSP pathway in influencing glioma cell proliferation.
25294877 Data suggest thet 67-kDa laminin receptor-dependent protein phosphatase 2A (67LR/PP2A) may be a promising therapeutic target for melanomas.
25274119 analysis of the complex three-way interaction between the non-integrin laminin receptor, galectin-3 and Neisseria meningitidis
25082063 Studies indicate that the expression of 37/67-kDa immature laminin receptor protein (iLRP)iLRP in the rodent and human fetus is phase specific
More...

AA Sequence

MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIEN      1 - 70
PADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYV     71 - 140
NLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEI    141 - 210
EKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAP    211 - 280
TAQATEWVGATTDWS                                                           281 - 295
//

Text Mined References (125)

PMID Year Title
26545108 2015 Knock-Down of the 37kDa/67kDa Laminin Receptor LRP/LR Impedes Telomerase Activity.
26427016 2015 Knockdown of LRP/LR Induces Apoptosis in Breast and Oesophageal Cancer Cells.
26146125 2015 The Transition of the 37-Kda Laminin Receptor (Rpsa) to Higher Molecular Weight Species: Sumoylation or Artifact?
26062445 2015 Discovery of new small molecules inhibiting 67 kDa laminin receptor interaction with laminin and cancer cell invasion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25840456 2014 [Connecting isolated congenital asplenia to the ribosome].
25800042 2015 67-kDa Laminin receptor contributes to hypoxia-induced migration and invasion of trophoblast-like cells by mediating matrix metalloproteinase-9.
25778325 67kDa laminin receptor regulates the activation of MAPKs through DUSPs in glioma cell line U251.
25294877 2014 67-kDa laminin receptor-dependent protein phosphatase 2A (PP2A) activation elicits melanoma-specific antitumor activity overcoming drug resistance.
25274119 2014 Deciphering the complex three-way interaction between the non-integrin laminin receptor, galectin-3 and Neisseria meningitidis.
More...