Property Summary

NCBI Gene PubMed Count 86
PubMed Score 353.73
PubTator Score 1212.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
oligodendroglioma 2849 4.46931225386483E-11
posterior fossa group B ependymoma 1530 2.42967940558723E-10
acute quadriplegic myopathy 1157 9.99073701233186E-8
malignant mesothelioma 3163 7.36773493729893E-6
medulloblastoma 1524 8.07881718904598E-6
atypical teratoid / rhabdoid tumor 4369 1.18667474560849E-5
osteosarcoma 7933 6.53070631944661E-5
lung cancer 4473 1.22456693774614E-4
pancreatic cancer 2300 1.2614392404697E-4
nasopharyngeal carcinoma 1056 4.14160591615454E-4
tuberculosis 1563 4.36388648493184E-4
ulcerative colitis 2087 8.44621774227216E-4
Pick disease 1893 8.76749877807647E-4
invasive ductal carcinoma 2950 0.00146406063425157
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00168545585860763
primitive neuroectodermal tumor 3031 0.00281963548547111
medulloblastoma, large-cell 6234 0.00379726506763411
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00402011713230405
active Crohn's disease 918 0.00446795859616311
Atopic dermatitis 944 0.00453525410601724
adult high grade glioma 2148 0.00757433748133755
psoriasis 6685 0.00830341177065907
glioblastoma 5572 0.0091937017695523
urothelial carcinoma 318 0.0123854780473515
astrocytic glioma 2241 0.0159138214550859
Alzheimer's disease 644 0.0317841809835388

Expression

  Differential Expression (26)

Synonym

Accession P08842 B2RA47
Symbols ES
ASC
XLI
ARSC
SSDD
ARSC1

Gene

STS

PANTHER Protein Class (1)

PDB

1P49  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 CSPA Cell Line (2)

Gene RIF (69)

PMID Text
26723541 Effects of steroid hormone on estrogen sulfotransferase and on steroid sulfatase expression in endometriosis tissue and stromal cells
26631368 The antagonistic actions of glucocorticoids and NFkB on STS expression are similar to the regulation of inflammatory response proteins
26458420 Data show that both estrogen sulfatase (STS) and estrogen sulfotransferase (EST) were highly expressed in the human umbilical vein endothelial cells (HUVECs).
26421812 Letter/Case Report: novel nonsense mutation in the STS gene in X-linked ichthyosis.
26220752 The induced STS facilitates the conversion of inactive estrogen sulfates to active estrogens, which in return attenuates the NF-kappaB-mediated inflammation.
26213785 represents one of the major pathways in regenerating biologically active steroids in both steroidogenic and nonsteroidogenic tissues [review]
26194504 In both arm and subumbilical skin biopsy of patients with idiopathic hirsutism, there was an up-regulation of STS mRNA expression.
25726327 Our analyses show that the two phenotypes in our patient are due to independent genetic defects: a genomic rearrangement involving the Kallmann syndrome 1 gene and a point mutation of the steryl-sulfatase gene.
25499601 Genetic variation in ARSC may be associated with change in mammographic density after women stop using estrogen-progestin therapy.
25042472 STS is present in human pre-osteoblastic bone cells and that it can influence bone cell growth
More...

AA Sequence

MPLRKMKIPFLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLA      1 - 70
ASPLCTPSRAAFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALIGKWHLGMS     71 - 140
CHSKTDFCHHPLHHGFNYFYGISLTNLRDCKPGEGSVFTTGFKRLVFLPLQIVGVTLLTLAALNCLGLLH    141 - 210
VPLGVFFSLLFLAALILTLFLGFLHYFRPLNCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPF    211 - 280
LLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEV    281 - 350
SSKGEIHGGSNGIYKGGKANNWEGGIRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRI    351 - 420
IDGRDLMPLLEGKSQRSDHEFLFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNGCFATHVCFCF    421 - 490
GSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQ    491 - 560
LCCPSTGLSCQCDREKQDKRLSR                                                   561 - 583
//

Text Mined References (87)

PMID Year Title
26723541 2016 Effects of steroid hormone on estrogen sulfotransferase and on steroid sulfatase expression in endometriosis tissue and stromal cells.
26631368 2016 Steroid sulfatase in the human MG-63 preosteoblastic cell line: Antagonistic regulation by glucocorticoids and NF?B.
26458420 2015 Melatonin affects the dynamic steady-state equilibrium of estrogen sulfates in human umbilical vein endothelial cells by regulating the balance between estrogen sulfatase and sulfotransferase.
26421812 2015 X-linked ichthyosis in a patient with a novel nonsense mutation in the STS gene.
26220752 2016 Inflammatory regulation of steroid sulfatase: A novel mechanism to control estrogen homeostasis and inflammation in chronic liver disease.
26213785 2015 The Regulation of Steroid Action by Sulfation and Desulfation.
26194504 2015 Is idiopathic hirsutism (IH) really idiopathic? mRNA expressions of skin steroidogenic enzymes in women with IH.
25726327 2015 Ichthyosis and Kallmann syndrome: not always a contiguous gene syndrome.
25499601 2014 Hormone metabolism pathway genes and mammographic density change after quitting estrogen and progestin combined hormone therapy in the California Teachers Study.
25042472 2014 Steroid sulfatase mediated growth Sof human MG-63 pre-osteoblastic cells.
More...