Property Summary

Ligand Count 246
NCBI Gene PubMed Count 92
PubMed Score 367.52
PubTator Score 1212.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 2.258 4.5e-03
active ulcerative colitis 1.252 9.1e-03
acute quadriplegic myopathy 2.085 1.0e-07
adult high grade glioma -1.500 7.6e-03
Alzheimer's disease -1.100 3.2e-02
astrocytic glioma -2.400 1.6e-02
Atopic dermatitis -1.300 4.5e-03
atypical teratoid / rhabdoid tumor -2.600 1.2e-05
ependymoma -1.600 1.2e-02
glioblastoma -1.200 2.3e-07
group 3 medulloblastoma -1.100 1.2e-02
intraductal papillary-mucinous adenoma (... 2.000 4.0e-03
intraductal papillary-mucinous neoplasm ... 3.800 1.7e-03
invasive ductal carcinoma -1.149 1.5e-03
lung cancer -1.100 1.5e-02
malignant mesothelioma -1.800 9.7e-08
medulloblastoma, large-cell -1.900 3.8e-03
nasopharyngeal carcinoma -1.100 4.1e-04
oligodendroglioma -1.100 1.7e-02
osteosarcoma 1.741 6.5e-05
pancreatic cancer 1.300 1.3e-04
Pick disease -1.400 8.8e-04
primitive neuroectodermal tumor -1.800 2.8e-03
psoriasis 1.400 3.8e-04
tuberculosis 1.100 4.4e-04
urothelial carcinoma -1.300 1.2e-02

 OMIM Phenotype (1)

 CSPA Cell Line (2)

Gene RIF (75)

AA Sequence

MPLRKMKIPFLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLA      1 - 70
ASPLCTPSRAAFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALIGKWHLGMS     71 - 140
CHSKTDFCHHPLHHGFNYFYGISLTNLRDCKPGEGSVFTTGFKRLVFLPLQIVGVTLLTLAALNCLGLLH    141 - 210
VPLGVFFSLLFLAALILTLFLGFLHYFRPLNCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPF    211 - 280
LLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEV    281 - 350
SSKGEIHGGSNGIYKGGKANNWEGGIRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRI    351 - 420
IDGRDLMPLLEGKSQRSDHEFLFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNGCFATHVCFCF    421 - 490
GSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQ    491 - 560
LCCPSTGLSCQCDREKQDKRLSR                                                   561 - 583
//

Text Mined References (93)

PMID Year Title