Property Summary

NCBI Gene PubMed Count 86
Grant Count 77
R01 Count 38
Funding $19,289,373.92
PubMed Score 353.73
PubTator Score 1212.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (50)

Disease Z-score Confidence
X-linked ichthyosis 18 6.871 3.4
Ichthyosis vulgaris 15 5.627 2.8
Chondrodysplasia punctata 41 4.708 2.4
Congenital ichthyosiform erythroderma 27 4.321 2.2
Thiel-Behnke corneal dystrophy 6 3.883 1.9
Schneckenbecken dysplasia 5 3.848 1.9
Hypogonadism 70 3.789 1.9
Ocular albinism 29 3.46 1.7
Smith-Lemli-Opitz syndrome 9 3.449 1.7
Cryptorchidism 67 3.363 1.7
Breast cancer 3,094 3.339 1.7
Corneal granular dystrophy 1 3.21 1.6
Chandler syndrome 5 3.2 1.6
Intellectual disability 573 3.037 1.5
Alzheimer's disease 644
Atopic dermatitis 944
Attention deficit hyperactivity disorder 156
Diabetes Mellitus, Experimental 106
Fatty Liver 48
Ichthyosis, X-Linked 1
Inflammation 109
Insulin Resistance 48
Obesity 616
Pick disease 1,893
Rheumatoid Arthritis 1,160
Steroid Sulfatase Deficiency Disease 1
Weight Gain 87
active Crohn's disease 918
acute quadriplegic myopathy 1,157
adult high grade glioma 2,148
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
glioblastoma 5,572
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
oligodendroglioma 2,849
osteosarcoma 7,933
pancreatic cancer 2,300
posterior fossa group B ependymoma 1,530
primitive neuroectodermal tumor 3,031
psoriasis 6,685
tuberculosis 1,557
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

  Differential Expression (26)

Synonym

Accession P08842 B2RA47
Symbols ES
ASC
XLI
ARSC
SSDD
ARSC1

Gene

STS

PANTHER Protein Class (1)

PDB

1P49  

Gene RIF (69)

PMID Text
26723541 Effects of steroid hormone on estrogen sulfotransferase and on steroid sulfatase expression in endometriosis tissue and stromal cells
26631368 The antagonistic actions of glucocorticoids and NFkB on STS expression are similar to the regulation of inflammatory response proteins
26458420 Data show that both estrogen sulfatase (STS) and estrogen sulfotransferase (EST) were highly expressed in the human umbilical vein endothelial cells (HUVECs).
26421812 Letter/Case Report: novel nonsense mutation in the STS gene in X-linked ichthyosis.
26220752 The induced STS facilitates the conversion of inactive estrogen sulfates to active estrogens, which in return attenuates the NF-kappaB-mediated inflammation.
26213785 represents one of the major pathways in regenerating biologically active steroids in both steroidogenic and nonsteroidogenic tissues [review]
26194504 In both arm and subumbilical skin biopsy of patients with idiopathic hirsutism, there was an up-regulation of STS mRNA expression.
25726327 Our analyses show that the two phenotypes in our patient are due to independent genetic defects: a genomic rearrangement involving the Kallmann syndrome 1 gene and a point mutation of the steryl-sulfatase gene.
25499601 Genetic variation in ARSC may be associated with change in mammographic density after women stop using estrogen-progestin therapy.
25042472 STS is present in human pre-osteoblastic bone cells and that it can influence bone cell growth
More...

AA Sequence

MPLRKMKIPFLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLA      1 - 70
ASPLCTPSRAAFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALIGKWHLGMS     71 - 140
CHSKTDFCHHPLHHGFNYFYGISLTNLRDCKPGEGSVFTTGFKRLVFLPLQIVGVTLLTLAALNCLGLLH    141 - 210
VPLGVFFSLLFLAALILTLFLGFLHYFRPLNCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPF    211 - 280
LLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEV    281 - 350
SSKGEIHGGSNGIYKGGKANNWEGGIRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRI    351 - 420
IDGRDLMPLLEGKSQRSDHEFLFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNGCFATHVCFCF    421 - 490
GSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQ    491 - 560
LCCPSTGLSCQCDREKQDKRLSR                                                   561 - 583
//

Text Mined References (87)

PMID Year Title
26723541 2016 Effects of steroid hormone on estrogen sulfotransferase and on steroid sulfatase expression in endometriosis tissue and stromal cells.
26631368 2016 Steroid sulfatase in the human MG-63 preosteoblastic cell line: Antagonistic regulation by glucocorticoids and NF?B.
26458420 2015 Melatonin affects the dynamic steady-state equilibrium of estrogen sulfates in human umbilical vein endothelial cells by regulating the balance between estrogen sulfatase and sulfotransferase.
26421812 2015 X-linked ichthyosis in a patient with a novel nonsense mutation in the STS gene.
26220752 2016 Inflammatory regulation of steroid sulfatase: A novel mechanism to control estrogen homeostasis and inflammation in chronic liver disease.
26213785 2015 The Regulation of Steroid Action by Sulfation and Desulfation.
26194504 2015 Is idiopathic hirsutism (IH) really idiopathic? mRNA expressions of skin steroidogenic enzymes in women with IH.
25726327 2015 Ichthyosis and Kallmann syndrome: not always a contiguous gene syndrome.
25499601 2014 Hormone metabolism pathway genes and mammographic density change after quitting estrogen and progestin combined hormone therapy in the California Teachers Study.
25042472 2014 Steroid sulfatase mediated growth Sof human MG-63 pre-osteoblastic cells.
More...