Property Summary

Ligand Count 2
NCBI Gene PubMed Count 258
PubMed Score 1156.13
PubTator Score 1034.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis -2.799 1.8e-06
glioblastoma 1.200 5.0e-02
inflammatory breast cancer -1.200 3.4e-04
ovarian cancer -1.100 1.3e-04
pancreatic cancer 2.000 7.0e-03
pediatric high grade glioma 1.200 5.0e-03

Gene RIF (226)

AA Sequence

MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAA      1 - 70
CGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHL     71 - 140
MAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNG    141 - 210
FYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN                         211 - 259
//

Text Mined References (259)

PMID Year Title