Property Summary

NCBI Gene PubMed Count 235
Grant Count 227
R01 Count 143
Funding $23,611,714.79
PubMed Score 1132.43
PubTator Score 1034.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis -2.799 0.000
glioblastoma 1.200 0.050
pancreatic cancer 2.000 0.007
pediatric high grade glioma 1.200 0.005
inflammatory breast cancer -1.200 0.000
ovarian cancer -1.100 0.000

Synonym

Accession P08833 A4D2F4 D3DVL9 Q8IYP5 IBP-1
Symbols AFBP
IBP1
PP12
IGF-BP25
hIGFBP-1

Gene

PDB

2DSQ   1ZT3   1ZT5  

Gene RIF (204)

PMID Text
26714229 mTOR inhibition constitutes a mechanistic link between hypoxia, reduced IGF-I bioavailability and fetal growth retardation.
26456333 the hepatokine IGFBP1 is a critical liver-bone hormonal relay that promotes osteoclastogenesis and bone resorption as well as an essential mediator of FGF21-induced bone loss
26245897 study shows up-regulation of MCSF in GBM via a SYK-PI3K-NFkappaB-dependent mechanism and identifies IGFBP1 released by microglial cells as a novel mediator of MCSF-induced angiogenesis
26232425 Activation of IGFBP1 by pregnane X receptor alters the morphology of hepatocellular carcinoma cells and regulates cell migration.
26118397 trend towards higher cord blood values in intrauterine growth restriction observed
26025665 gene expression analysis of human breast tumors showed that high expression of IGFBP mRNA was strongly correlated with good prognosis but not when MMP9 mRNA was also highly expressed
25957086 The amino acid response and mTOR independently regulate IGFBP-1 secretion and phosphorylation in response to decreased amino acid availability.
25890304 There was a positive correlation between the IGFBP1 levels of and those of inflammatory mediators in HIV Infections.
25869614 Data suggest that expression of IGFBP1 in hepatocytes can be regulated by carnosine, a dietary factor; carnosine down-regulates expression of IGFBP1 in Hep G2 cells; mechanism involves suppression of HIF1A (hypoxia inducible factor 1 alpha subunit).
25757011 HIF-2alpha acts as an important negative regulator of hepatic lymphangiogenesis in vitro and in vivo by inducing IGFBP1.
More...

AA Sequence

MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAA      1 - 70
CGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHL     71 - 140
MAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNG    141 - 210
FYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN                         211 - 259
//

Text Mined References (237)

PMID Year Title
26714229 2016 Hypoxia Increases IGFBP-1 Phosphorylation Mediated by mTOR Inhibition.
26456333 2015 A Liver-Bone Endocrine Relay by IGFBP1 Promotes Osteoclastogenesis and Mediates FGF21-Induced Bone Resorption.
26245897 2015 Glioblastoma-derived Macrophage Colony-stimulating Factor (MCSF) Induces Microglial Release of Insulin-like Growth Factor-binding Protein 1 (IGFBP1) to Promote Angiogenesis.
26232425 2015 Pregnane X Receptor Represses HNF4? Gene to Induce Insulin-Like Growth Factor-Binding Protein IGFBP1 that Alters Morphology of and Migrates HepG2 Cells.
26118397 2015 Differential effects of low birthweight and intrauterine growth restriction on umbilical cord blood insulin-like growth factor concentrations.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26025665 2015 Presence of insulin-like growth factor binding proteins correlates with tumor-promoting effects of matrix metalloproteinase 9 in breast cancer.
25957086 2015 IGFBP-1 hyperphosphorylation in response to leucine deprivation is mediated by the AAR pathway.
25890304 2015 Insulin-like growth factors and related proteins in plasma and cerebrospinal fluids of HIV-positive individuals.
25869614 2015 Carnosine decreases IGFBP1 production in db/db mice through suppression of HIF-1.
More...