Property Summary

NCBI Gene PubMed Count 47
PubMed Score 149.33
PubTator Score 206.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 3.900 1.2e-08
adult high grade glioma -1.100 6.2e-03
Atopic dermatitis 3.800 4.3e-04
Breast cancer -1.200 2.2e-03
cutaneous lupus erythematosus 3.300 1.8e-04
esophageal adenocarcinoma -2.800 3.1e-02
non-small cell lung cancer 3.976 1.3e-12
pancreatic cancer 1.400 1.9e-03

Gene RIF (21)

AA Sequence

MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGGACGLGGGYGG      1 - 70
GFSSSSSFGSGFGGGYGGGLGAGFGGGLGAGFGGGFAGGDGLLVGSEKVTMQNLNDRLASYLDKVRALEE     71 - 140
ANADLEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNKIIAATIENAQPILQIDNARLAADDFRTKYEHEL    141 - 210
ALRQTVEADVNGLRRVLDELTLARTDLEMQIEGLKEELAYLRKNHEEEMLALRGQTGGDVNVEMDAAPGV    211 - 280
DLSRILNEMRDQYEQMAEKNRRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQ    281 - 350
LSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKTRLEQEIATYRRL    351 - 420
LEGEDAHLSSQQASGQSYSSREVFTSSSSSSSRQTRPILKEQSSSSFSQGQSS                     421 - 473
//

Text Mined References (52)

PMID Year Title