Property Summary

NCBI Gene PubMed Count 162
Grant Count 352
R01 Count 170
Funding $46,690,343.91
PubMed Score 6426.86
PubTator Score 4068.02

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P08758 D3DNW7 Q6FHB3 Q6FI16 Q8WV69 Q9UDH9
Symbols PP4
ANX5
ENX2
RPRGL3
HEL-S-7

Gene

PDB

1ANW   1ANX   1AVH   1AVR   1HAK   1HVD   1HVE   1HVF   1HVG   1SAV   2XO2   2XO3  

Gene RIF (125)

PMID Text
26371709 The M2 haplotype is a risk factor for early spontaneous abortions, before the 12th week of gestation, and confers about the same relative risk to carriers of both sexes.
26160872 Chronically increased alveolar annexin V levels, as reflected in increased idiopathic pulmonary fibrosis (IPF) BALF levels, may contribute to the progression of IPF by inducing the release of pro-fibrotic mediators.
26135579 annexin A5 promoter haplotype M2 may not have a role in recurrent pregnancy loss in Estonia or Denmark
25899647 Annexin V is fused to an enzyme, creating a fusion protein that converts nontoxic drug precursors, prodrugs, into anticancer compounds while bound to the tumor, therefore mitigating the risk of side effects.
25799159 Anx5 could protect cardiomyocytes adherens junctions and improve myocardial contractile function via regulation of p120 and anti-inflammation in LPS-induced endotoxemia.
25796304 lower exhaled breath condensate annexin A5 levels in children with exercise-induced asthma compared to non-exercised-induced one
25682309 The associated male partner risk confirms the proposed role of M2/ANXA5 as a genetic trait impeding embryonic anticoagulation.
25661914 The prognostic value of AnV and T cell apoptosis was evaluated in children with nephrotic syndrome in this review.
25595530 AnxA5 promotes membrane resealing of injured human trophoblasts.
25525746 ANXA5 haplotypes/plasma ANXA5 levels were not associated with carotid IMT progression or cardiovascular disease risk in familial hypercholesterolemia patients.
More...

AA Sequence

MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLK      1 - 70
SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDD     71 - 140
VVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVF    141 - 210
DKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEID    211 - 280
LFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD                                  281 - 320
//

Text Mined References (173)

PMID Year Title
26371709 2015 Investigation of the Annexin A5 M2 haplotype in 500 white European couples who have experienced recurrent spontaneous abortion.
26160872 2015 Increased alveolar soluble annexin V promotes lung inflammation and fibrosis.
26135579 2015 Annexin A5 Promoter Haplotype M2 Is Not a Risk Factor for Recurrent Pregnancy Loss in Northern Europe.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25899647 2015 Annexin V-Directed Enzyme Prodrug Therapy Plus Docetaxel for the Targeted Treatment of Pancreatic Cancer.
25799159 2015 Recombinant Human Annexin A5 Can Repair the Disrupted Cardiomyocyte Adherens Junctions in Endotoxemia.
25796304 Exhaled breath condensate annexin A5 levels in exercise-induced bronchoconstriction in asthma: A preliminary study.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25682309 2015 M2/ANXA5 haplotype as a predisposition factor in Malay women and couples experiencing recurrent spontaneous abortion: a pilot study.
25661914 2015 [Importance of annexin V in kidney diseases].
More...